KEGG   Streptomyces avermitilis: SAVERM_3566Help
Entry
SAVERM_3566       CDS       T00126                                 

Gene name
ppc
Definition
(GenBank) putative phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sma  Streptomyces avermitilis
Pathway
sma00620  Pyruvate metabolism
sma00680  Methane metabolism
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
Module
sma_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sma00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAVERM_3566 (ppc)
  Energy metabolism
   00680 Methane metabolism
    SAVERM_3566 (ppc)
Enzymes [BR:sma01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SAVERM_3566 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: BAC71278
NITE: SAV3566
UniProt: Q82HE3
LinkDB All DBs
Position
complement(4415436..4418168)
Genome map
AA seq 910 aa AA seqDB search
MSSADDQTTTTSSELRADIRRLGDLLGETLVRQEGPELLDLVEKVRRLTREDGEAAAELL
RGTELETAAKLVRAFSTYFHLANVTEQVHRGRELRTKRAAEGGLLARTADRLKDADPEHL
RATVKNLNVRPVFTAHPTEAARRSVLNKLRRIAALLETPVIEADRRRYDTRLAENIDLVW
QTDELRVVRPEPADEARNAIYYLDELHAGAVGDVLEDLTAELERVGVQLPDDTRPLTFGT
WIGGDRDGNPNVTPEVTWDVLILQHEHGINDALELIDELRGFLSNSIRYTGATEELLTSL
GTDLERLPEISPRYKRLNAEEPYRLKATCIRQKLENTKQRLAKGTAHQPGRDYLGTGELL
HDLKLIQTSLREHRGGLFADGRMDRTIRTLAAFGLQLATMDVREHADAHHYALGQLFDRL
GEESWRYADMPRDYRGKLLAKELRSRRPLAPSPAPLDAAGAKTLGVFHTVKRALAVFGPE
VIESYIISMCQGADDVFAAAVLAREAGLLDLHAGWAKIGIVPLLETTDELKAADTILEDM
LSDPSYRRLVALRGDVQEVMLGYSDSSKFGGITTSQWEIHRAQRRLRDVAHRYGVRLRLF
HGRGGTVGRGGGPSHDAILAQPWGTLEGEIKVTEQGEVISDKYLVPSLARENLELTVAAT
LQASALHTAPRQSDEALARWDAAMDVVSDAAHSAYRRLVEDPDLPTYFLASTPVDQLADL
HLGSRPSRRPGSGVSLDGLRAIPWVFGWTQSRQIVPGWFGVGSGLKALREAGLDTVLDEM
HEQWHFFRNFLSNVEMTLAKTDLRIARHYVDTLVPDHLKHVFATIEAEHELTVREVLRIT
GGEKLLDTHPVLQQTFAIRDAYLDPISYLQVALLKRQRDAAAADTPPDPLLARALLLTVN
GVAAGLRNTG
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagtgccgacgaccagaccaccacgaccagcagcgagctgcgcgccgacatcagg
cgcctgggcgacctcctgggcgagaccctcgtccgtcaggagggccccgaactcctcgac
ctggtcgagaaggtccgccgcctgacccgcgaggacggcgaagcagccgccgagctgctg
cgtggcacggaactcgagaccgcggccaagctggtccgcgccttctccacctacttccac
ctggcgaacgtcaccgaacaggtgcaccgtggccgagaactgcgcaccaagcgcgccgcc
gaaggcggacttctcgcccgtaccgccgaccggctgaaggacgcggaccccgagcacctg
cgcgcgacggtcaagaacctcaacgtccgccccgtgttcaccgcccaccccacggaagcc
gcccgccgctcggtgctgaacaagctccgccggatcgccgcactcctggagaccccggtc
atcgaggcggaccgccgccgctacgacacccggctggccgagaacatcgacctcgtctgg
cagaccgacgaactgcgcgtcgtccgccccgagcccgccgacgaggcccgcaacgccatc
tactacctcgacgaactgcacgccggcgccgtgggcgacgtcctggaagacctcacggcc
gagctcgagcgggtcggcgtacagctccccgacgacacccgccccctcaccttcggcacc
tggatcggcggcgaccgcgacggcaaccccaacgtcacccccgaggtgacctgggacgtc
ctcatcctccagcacgagcacggcatcaacgacgccctcgagctcatcgacgaactccgc
ggcttcctctccaactccatccgctacacgggagcgaccgaggaactgctgacgtcgctc
gggaccgacctcgaacgcctgcccgagatcagcccgcgctacaagcgcctcaacgccgaa
gagccctaccggctcaaggccacctgcatccggcagaagctcgagaacaccaagcagcgc
ctcgccaagggcaccgcccaccagcccggccgcgactacctcggcaccggcgaactgctc
cacgacctcaagctgatccagacctccctgcgcgagcaccgcggcggcctcttcgccgac
ggccgcatggaccgcaccatccgcacactcgccgccttcggcctccagctcgccaccatg
gacgtacgcgaacacgccgacgcccaccactacgcactcggccagctcttcgaccgcctc
ggcgaggaatcctggcgctacgccgacatgccccgcgactaccgcggcaagctcctcgcc
aaggaactgcgttccagaaggccgctcgctcccagccccgccccgctcgacgcggccggc
gccaagaccctcggcgtcttccacaccgtcaagcgagccctcgcagtcttcggacccgag
gtcatcgagtcgtacatcatctcgatgtgccagggcgccgacgacgtcttcgccgccgcc
gtcctcgcccgcgaggccggactcctcgacctgcacgccggctgggccaagatcggcatc
gtgccgctcctggagaccaccgacgagctcaaggccgcggacaccatcctcgaagacatg
ctctccgacccgtcctaccgccgcctggtcgccctgcgcggcgacgtccaggaggtcatg
ctcgggtactccgactcgtccaagttcggcggcatcaccaccagccagtgggagatccac
cgcgcccagcgacgcctgcgcgacgtcgctcaccgctacggcgtacgcctgcgcctcttc
cacggccgcggcggcaccgtgggccgtggcggcggcccctcccacgacgcgatcctcgcc
cagccctggggcaccctggagggcgagatcaaggtgaccgagcagggcgaggtcatctcc
gacaagtacctcgtcccctcgctcgcccgcgagaacctcgaactgacggtcgccgcgacg
ctccaggcgtccgccctgcacaccgcgccccgccagtccgacgaggcgctggcccgctgg
gacgcggcgatggacgtcgtctccgacgccgcccactccgcttaccggcggctcgtcgag
gaccctgacctgccgacgtacttcctcgcctccacgccggtcgaccagctcgccgacctg
cacctgggctcgcggccctcccgtcgccccggctcgggcgtctcgctcgacggactgcgc
gccatcccgtgggtcttcggctggacccagtcccggcagatcgtgcccggctggttcggc
gtcggctccggtctcaaggcactgcgcgaggcgggcctggacaccgtgctcgacgagatg
cacgagcagtggcacttcttccggaacttcctctcgaacgtcgagatgaccctcgcgaag
accgacctgcggatcgcccgccactacgtcgacaccctcgtcccggaccacctcaagcac
gtcttcgccaccatcgaggccgagcacgaactcaccgtccgtgaggtcctgcggatcacc
ggcggggagaagctcctggacacccaccccgtcctccagcagaccttcgccatccgcgac
gcctacctcgacccgatctcctacctccaggtcgccctgctcaagcgccagcgcgacgcc
gcggcagcggacacgccccccgacccgctcctggcccgcgccctgctcctcaccgtcaac
ggcgtggcggccggcctgcgcaacaccggctga

DBGET integrated database retrieval system