KEGG   Streptomyces avermitilis: SAVERM_4650Help
Entry
SAVERM_4650       CDS       T00126                                 

Definition
(GenBank) putative aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sma  Streptomyces avermitilis
Pathway
sma00010  Glycolysis / Gluconeogenesis
sma00053  Ascorbate and aldarate metabolism
sma00071  Fatty acid degradation
sma00280  Valine, leucine and isoleucine degradation
sma00310  Lysine degradation
sma00330  Arginine and proline metabolism
sma00340  Histidine metabolism
sma00380  Tryptophan metabolism
sma00410  beta-Alanine metabolism
sma00561  Glycerolipid metabolism
sma00620  Pyruvate metabolism
sma00625  Chloroalkane and chloroalkene degradation
sma00903  Limonene and pinene degradation
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVERM_4650
   00053 Ascorbate and aldarate metabolism
    SAVERM_4650
   00620 Pyruvate metabolism
    SAVERM_4650
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAVERM_4650
   00561 Glycerolipid metabolism
    SAVERM_4650
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAVERM_4650
   00310 Lysine degradation
    SAVERM_4650
   00330 Arginine and proline metabolism
    SAVERM_4650
   00340 Histidine metabolism
    SAVERM_4650
   00380 Tryptophan metabolism
    SAVERM_4650
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SAVERM_4650
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SAVERM_4650
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SAVERM_4650
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SAVERM_4650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: BAC72362
NITE: SAV4650
UniProt: Q82EG5
LinkDB All DBs
Position
5673611..5675071
Genome map
AA seq 486 aa AA seqDB search
MSSYFTDLAQQYIGGEWRPGTGSWDIIDFNPYDGEKLASITIATVDEVDEAYRAAAAAQK
EWAATNAYARRAVFQRALRLIEDREAEITEAIIAELGGTHLKAGFELHLAKQFLLESINL
ALRPEGRIIPSPVDGKENRLYRVPVGVVGVISPFNFPFLLSLKSVAPALALGNGVVLKPH
QNTPIVGGSLIAKIFEDAGLPGGLLNVVITDIAEIGDAFLEHPVPKVISFTGSDKVGRHV
ATVCAAQFKRSVLELGGNSALVVLEDADIDYAVDAAVFSRYVHQGQVCMAANRVLVDRSI
EAEFTEKFVAKVKTLKSGDPRDPQTIIGPVINSSQADAISGAVDQAIADGAIALVHGTTT
DNLVEPSVLTGLAADAPILQEEIFGPVALLIPFEGEEEAVRIVNDTPYGLSGAVHTADVE
RGVAFAKQIDTGMFHVNDGTVHDEPLVAFGGEKSSGIGRLNGEATVESFTTQKWISVQHG
RSFFPF
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcctacttcaccgatctggctcagcagtacatcggtggtgagtggcgcccgggc
acagggtcctgggacatcatcgacttcaacccgtacgacggtgagaagctcgcgtcgatc
accatagccacggtcgacgaggtggacgaggcctaccgggcggccgccgcggcccagaag
gaatgggcggcgaccaacgcgtatgcccgccgtgccgtgttccagcgggccctgcgcctc
atcgaggaccgcgaggccgagataaccgaggccatcatcgccgagctcggcggcacgcat
ctgaaggccggcttcgagctgcacctcgccaagcagttcctcctggagtcgatcaacctg
gcgctgcgccccgagggacggatcatcccctcgccggtcgacggcaaggagaaccgcctc
taccgcgtgcccgtcggcgtcgtcggcgtgatcagcccgttcaacttccccttcctcctg
tcgctgaagtccgtcgccccggccctggccctcggcaacggcgtggtcctcaagccgcac
cagaacacaccgatcgtcggcggctcgctgatcgcgaagatcttcgaggacgcgggtctg
ccgggcggcctcctgaacgtcgtgatcaccgacatcgcggagatcggcgacgcctttctc
gagcacccggtcccgaaggtcatctccttcaccggctccgacaaggttggccgccacgtg
gccaccgtctgcgccgcccagttcaagcgctcggtgctcgaactcggcggcaacagcgcc
ctggtggtcctggaggacgcggacatcgactacgccgtggacgccgcggtcttcagccgg
tacgtgcaccaggggcaggtctgcatggccgcgaaccgcgttctcgtggaccgctcgatc
gaggcggagttcaccgagaagttcgtcgccaaggtgaagacgctgaagtccggtgacccg
cgcgacccgcagacgatcatcggcccggtcatcaactcctcgcaggcggacgcgatctcg
ggcgccgtcgaccaggcgatcgcggacggcgccatcgcgctggtgcacggcaccaccacg
gacaacctcgtggagccgtccgtcctgaccggcctggccgccgacgcgcccatcctccag
gaggagatcttcggcccggtcgcgctcctcatccccttcgagggcgaggaggaggcggtc
cgtatcgtcaacgacaccccgtacggcctgagcggcgccgtccacacggccgacgtcgag
cgcggtgtcgccttcgccaagcagatcgacaccggcatgttccacgtcaacgacggcacc
gtccacgacgagccgctggtcgccttcggcggcgagaagtcctcgggcatcggccggctg
aacggcgaggcgacggtcgagtcgttcaccacgcagaagtggatctcggtgcagcacggg
cggagcttcttcccgttctga

DBGET integrated database retrieval system