KEGG   Streptomyces avermitilis: SAVERM_5003Help
Entry
SAVERM_5003       CDS       T00126                                 

Gene name
glpD2
Definition
(GenBank) putative glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sma  Streptomyces avermitilis
Pathway
sma00564  Glycerophospholipid metabolism
sma01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SAVERM_5003 (glpD2)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SAVERM_5003 (glpD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_binding_2 FAD_oxidored Pyr_redox_2 DUF5069
Motif
Other DBs
NCBI-ProteinID: BAC72715
NITE: SAV5003
UniProt: Q82DH4
LinkDB All DBs
Position
6053578..6055284
Genome map
AA seq 568 aa AA seqDB search
MRTATLGPAERAESLAGMAERELDVLVVGGGVVGAGTALDAVTRGLSTGIVEARDWASGT
SSRSSKLIHGGLRYLEMLDFALVREALKERGLLLERLAPHLVKPVPFLYPLQHKGWERLY
AGAGVALYDAMSMAPGHGRGLPTHRHLTRSHALRVAPALKKEALVGALQYYDAQMDDARY
VAMLVRTAAAYGAKAANRARVTDFLREGERVVGARVQDVEGGGEYEIHARQVVNATGVWT
DDTQAMVGERGQFHVRASKGIHLVVPKDRIHSTTGLILRTEKSVLFVIPWGRHWIVGTTD
TPWDLDKAHPAASSADIDYLLEHVNSVLSVPLSRDDVQGVYAGLRPLLAGESDATSKLSR
EHTVAHPVPGLVVVAGGKYTTYRVMAKDAVDEAVHGLDQRVADCVTEDIPLIGAEGYRAL
WNARARIAARTGLHVVRVEHLLNRYGSLAEELLDLVAADPSLGAPLQAADDYLRAEIVYA
ASHEGARHLDDVLTRRTRISIETFDRGTRSAREAAELMAPVLGWDKDQIEREIEHYEKRV
EAERESQRQPDDLTADAARLGAPDIVPR
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
gtgaggacagcgacactggggccggcggagcgcgccgagtcactggcgggaatggccgag
cgcgagctggacgtgctggtcgtgggcggcggcgtggtcggcgcgggtaccgcgctggac
gccgtgacacgcggcctgtccacaggcatcgtcgaggcacgggactgggcgtccggcaca
tccagcaggtccagcaagctgatacacggcggcctgcgctatctggagatgctcgacttc
gcccttgtgcgcgaggcactcaaggagcgcgggctgctcctggagcggctggcgccgcac
ctcgtgaagcccgtcccgttcctctaccccttgcagcacaagggctgggagcggctgtac
gcgggcgccggggtcgcgctgtacgacgccatgtcgatggcgcccggacacggccgcgga
ctgcccacgcaccgccatctgacccgcagccacgccctgcgcgtcgcgccggccctgaag
aaggaggcgctggtcggcgcgctccagtactacgacgcccagatggacgacgcccgctat
gtggcgatgctggtgcgcacggcggcggcgtacggcgcgaaggcggcgaaccgcgcgcgc
gtgaccgacttcctgcgcgagggcgagcgcgttgtcggtgccagggtgcaggacgtggaa
ggcggcggggagtacgagatccatgcccggcaggtcgtcaacgccacgggggtgtggacc
gatgacacccaggcgatggtcggggagcgggggcagttccacgtacgggcgtccaagggc
atacatctggtcgtgccgaaggaccggatccactccacgaccggtctgatcctgcggacc
gagaagtccgtgctgttcgtgatcccgtgggggcgccactggatcgtcggcaccaccgac
accccctgggacctcgacaaggcacacccggccgcctccagcgcggacatcgactacctg
ctcgaacacgtgaactcagtgctgtcggtgcccctttcgcgcgacgacgtccagggcgtg
tacgcgggtctgcggccgctgctcgccggagagtcggacgccaccagcaagctgtcgcgc
gagcacaccgtggcccatccggtgccggggctggtggtcgtcgcgggcggcaagtacacg
acgtaccgggtcatggccaaggacgcggtcgacgaggcggtgcacggcctcgaccagcgc
gtcgccgactgcgtcaccgaggacattccgctgatcggcgccgaggggtaccgggcgctg
tggaacgcgcgagcgcggatcgcggcccgcaccgggctccatgtggtgcgcgtggagcac
ctgctgaaccgttacggctcgctcgcggaggaactgctcgacctggtggcggccgatccc
tcgctgggcgcgccgctccaggccgccgacgactatctgcgggcggaaatcgtctatgcc
gcctcgcacgagggcgcgcggcacctggacgacgtactgacccggcgcacccgcatctcg
atcgagacgttcgaccgcggcacacgcagcgcccgcgaggccgccgaactgatggcgccg
gtcctcggctgggacaaggaccagatcgagcgcgagatcgagcactacgagaagcgggtc
gaggcggagcgggagtcgcagcgccagccggacgacctgacggcggacgcggcgcggctg
ggggcgccggacatcgtgccgcggtga

DBGET integrated database retrieval system