KEGG   Streptomyces avermitilis: SAVERM_563Help
Entry
SAVERM_563        CDS       T00126                                 

Gene name
mhpA
Definition
(GenBank) putative 3-(3-hydroxy-phenyl)propionate hydroxylase
  KO
K05712  3-(3-hydroxy-phenyl)propionate hydroxylase [EC:1.14.13.127]
Organism
sma  Streptomyces avermitilis
Pathway
sma00360  Phenylalanine metabolism
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
sma01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    SAVERM_563 (mhpA)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.127  3-(3-hydroxyphenyl)propanoate hydroxylase
     SAVERM_563 (mhpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_3 FAD_oxidored NAD_binding_8 DAO Pyr_redox_2 Pyr_redox HI0933_like Pyr_redox_3 GIDA Thi4 SE
Motif
Other DBs
NCBI-ProteinID: BAC68273
NITE: SAV0563
UniProt: Q82QE6
LinkDB All DBs
Position
complement(713315..714925)
Genome map
AA seq 536 aa AA seqDB search
MKAASQRPVVIIGGGPVGVMAGLLLARYGVRSLLLERHRDIYPLPRAVVVDDEIRRILQS
VGVHEDFAALARPALGLRLLDARRRVITEFPRSMHGHHGFPETSMFDQPELERVLRSALA
RRPECELQGGVEVVSVTQDTDGPNDPTGPARVTFRRDGSDEEEHVWADAVLGCDGAGSLT
RDSIGAVWEDLHFQESWRVIDVRTTRQVRTWEGAEQICCPNRPATFMRVGEDRYRWEFRL
PEDENLDGPDGWERLRELVAPWVDLPPDASAGDDFEVVRQAQYTFRARLADRWRRGRVFL
LGDAAHLTPPFVGQGLCAGLRDAYNLTWKLARVLQQGAHDGLLDTYERERKPHARHVIRV
AVAVGWAMTGGQDRGAAFRRAVVGTASRIPGVTAAVSRDLSPALTAGPLVRRRPRLTGRV
LAGTICPQPWVRHDGRRVRLDDVLGDSFAVVTAVPPTAQMTAVATALGAPTVHVEDLRDD
GTLAGWLARGRADAVLLRPDRVVMDTVQAGTGDFTDTVAWAPLLHTARHTADARPA
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggccgcatcccagaggccggtggtgatcatcggtgggggacccgtcggggtcatg
gccggcctgctgctcgcccggtacggagtgcgcagcttgctcctcgaacgccatcgggac
atctaccctctgccgcgcgccgtcgtcgtggacgacgagatccgtcggatcctgcaaagc
gtcggtgtccacgaggatttcgctgctctcgcccgcccggcgctcgggctgcggctgctg
gacgcccggcgccgcgtgatcaccgagttcccgcggtccatgcacggacaccacggcttc
ccggagaccagcatgttcgaccagcccgagctggaacgcgtgctgcgcagcgccctggcg
cgccgcccggagtgcgagctgcagggcggggtggaggtcgtgtccgtcacccaggacacc
gacggaccgaacgatccgacgggtccggcccgggtcaccttccgccgcgacggcagcgac
gaggaggagcacgtgtgggccgatgccgtcctcggctgcgacggcgcgggcagcctcacc
cgtgactccatcggcgccgtgtgggaggacctgcacttccaggagagctggagagtcatc
gacgtgcgcaccacccgccaggtgcgcacctgggaaggcgccgagcagatctgctgcccc
aaccgaccggccaccttcatgcgcgtcggcgaggaccgctaccgctgggagttccggctg
cccgaggacgaaaacctggacggcccggacggatgggagcgcctgcgcgagctggtcgcc
ccctgggtggacctgccgcccgacgcctcggcgggcgacgacttcgaggtggtgcggcag
gcgcagtacaccttccgggcccgcctcgccgaccgatggcgcagggggcgtgtcttcctg
ctgggcgacgccgcccacctcaccccgcccttcgtcgggcagggtctgtgcgcgggcctg
cgcgacgcctacaacctcacctggaagctcgcccgcgtgctccaacagggcgcacacgac
gggctgctggacacctacgaacgcgagcgcaagccgcacgcccgccatgtgatccgcgtc
gcggtcgccgtcggctgggccatgaccggcggacaggaccgcggtgcggcgttccgccgg
gccgtcgtgggcacggcctctcgcatccccggcgtgaccgcggcggtgagccgtgacctc
agccccgccctgaccgccggtccactcgtacggcgccgccccaggctgaccggccgcgtg
ctggccggcacgatctgcccgcagccctgggtacggcatgacggcaggcgagtgcgcctc
gatgacgtcctcggggactccttcgccgtcgtgaccgctgtgccgcccacggcgcagatg
acggccgtggctacggcactgggcgctccgacggtccacgtcgaggacctgcgcgacgac
ggcaccctggccggctggctggcacgcggccgtgccgacgccgtcctgctgcgccccgac
cgcgtcgtgatggacaccgtccaggccggcaccggcgacttcacggacaccgtcgcctgg
gcccccctgctgcacacggcccgccataccgccgacgcccggcccgcctga

DBGET integrated database retrieval system