KEGG   Streptomyces avermitilis: SAVERM_5766Help
Entry
SAVERM_5766       CDS       T00126                                 

Gene name
galM1
Definition
(GenBank) putative aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
sma  Streptomyces avermitilis
Pathway
sma00010  Glycolysis / Gluconeogenesis
sma00052  Galactose metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01130  Biosynthesis of antibiotics
Module
sma_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:sma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVERM_5766 (galM1)
   00052 Galactose metabolism
    SAVERM_5766 (galM1)
Enzymes [BR:sma01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     SAVERM_5766 (galM1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim TAT_signal
Motif
Other DBs
NCBI-ProteinID: BAC73478
NITE: SAV5766
UniProt: Q82BD9
LinkDB All DBs
Position
complement(6970843..6971994)
Genome map
AA seq 383 aa AA seqDB search
MELNRRTLIAGTAAAGIAATTLGGTAQAAPGSGRPVKELFGKLADGTKIYRWSLENGGTR
LKVLSYGGIVQSLEIPDRHGRYKNVSLGFATIEDYVAKTPYFGALIGRYGNRIAKGRFDL
DGKSYQLSVNDGVNSLHGGAKGFDKRPWDIEGFTSGSDVGLHLYYTSVDGEMGYPGTLKA
KVTYTLTRHGDWRIDYEATTDKATVVNLTSHVYWNLAGEGSGSIYDHELKIAAARYTPVD
SGLIPTGELAKVAGTPFDFRRTKTVGEDIREANQQLLYGKGIDHNWVLDKGITAKPAHVA
TLRDPSSGRTLRIATTEPGLQFYSGNFLDGTLVGPGGHIYRQGDALCLETQHFPNSPNQP
AFPSTVLRPGETYRSSTVHSFDA
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggaactgaacagacgcacactcatcgcgggcaccgcggccgcgggcatcgcggcgacc
acgctcggcgggacggcacaggccgccccgggaagcggaaggccggtgaaggagctcttc
ggcaagctcgccgacgggacgaagatctaccgctggtcgctggagaacggcggcacccgg
ctgaaggtcctgtcgtacggcggcatcgtccagtccctggagatcccggaccggcacggc
cgctacaagaacgtgtcgctgggcttcgccaccatcgaggactacgtcgcgaagaccccg
tacttcggcgcgctcatcggccggtacggaaaccgtatagccaagggccggttcgacctc
gacggcaagtcctaccagctgtccgtcaacgacggggtcaacagcctgcacggcggcgcc
aagggcttcgacaagcgcccctgggacatcgagggcttcacctccggttcggacgtgggc
ctgcacctgtactacacgagcgtcgacggcgagatgggctacccgggcacgctcaaggcg
aaggtcacctacacgctgaccaggcacggcgactggcgcatcgactacgaggccaccacc
gacaaggccaccgtcgtcaacctcaccagccatgtctactggaacctggcgggcgagggc
agcggctcgatctacgaccacgaactgaagatcgccgccgcccgctacacccccgtcgac
tcgggcctgatccccaccggtgagctggccaaggtcgcgggcacccccttcgacttccgc
cgtacgaagaccgtcggcgaggacatccgagaggcgaaccagcagctcctgtacggcaag
ggcatcgaccacaactgggtcctcgacaaggggatcacggcgaagcccgcgcacgtcgcg
acgctccgggacccgtcctcgggccgcacgctgaggatcgcgacgaccgagccgggcctt
cagttctactccggcaacttcctggacggcacactggtcggccccggcgggcacatctac
cgccagggcgacgcgctgtgcctggagacccagcacttccccaactcgccgaaccagccg
gcgttcccgtcgacggtgctgcggccgggcgagacctaccgcagctcgacggtgcactcg
ttcgacgcctga

DBGET integrated database retrieval system