KEGG   Streptomyces avermitilis: SAVERM_5852Help
Entry
SAVERM_5852       CDS       T00126                                 

Definition
(GenBank) putative aldehyde dehydrogenase
Organism
sma  Streptomyces avermitilis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: BAC73564
NITE: SAV5852
UniProt: Q82B53
LinkDB All DBs
Position
7060741..7062249
Genome map
AA seq 502 aa AA seqDB search
MRPGRQSAMTELVEHGQLFIGGVLADPLGKDVIEVISPHTEEVIGRVPHASTADVDRAVA
VARKAFDEGPWPRATLDERIEVVTRIKDAIAVRHEEIARVISSENGSPYSWSVLAQALGA
MMVWDAAITVARNFTYEETRDGVLGKIVVRREPVGVVAAVVPWNVPQFVAAAKLAPALLT
GCTVVLKPSPESPLDAYLLGEIAREAGLPEGVLSILPADREVSEYLVGHPGIDKVSFTGS
VAAGRRVMEVASRNLTRVTLELGGKSAAVVLPDADITTSVPGIVSAAWMNNGQACVAQTR
ILVPRSRYDEFADAFAAAASALVVGDPLDPATQVGPLVARRQQRRNLDYIRIGQEEGAKI
LTGGGRPPGLDRGWYVEPTLFGDVDNSMRIAREEIFGPVICLLPYGDETEAVKIANDSDY
GLSGSVWTADVEHGIDVARRVRTGTYSVNTFSLDMLGPFGGYKNSGLGREFGPEGYGEFL
EHKMIHLPAGYEAPTGVEGAGA
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtcccgggaggcagtcggccatgaccgagctcgtggaacacggacagctgttcatc
ggcggggtgttggcggacccgctgggcaaggacgtcatcgaggtgatctccccgcacacc
gaggaggtcatcggacgggtgccgcacgcctccacggcggacgtggaccgcgcggtcgcc
gtcgcgcgcaaggcgttcgacgagggcccctggccgcgcgcgaccctcgacgagcgcatc
gaggtcgtcacccggatcaaggacgccatcgcggtacggcacgaggagatcgcccgggtc
atctcctccgagaacggttcgccgtactcctggagcgtcctcgcgcaggccctcggcgcg
atgatggtgtgggacgcggcgatcacggtcgcgcggaacttcacctacgaggagacccgc
gacggagtcctcgggaagatcgtggtgcggcgcgagccggtgggcgtggtcgcggccgtg
gtcccgtggaacgtgccgcagttcgtcgccgccgccaagctcgcccccgcgctgctgacc
ggctgcacggtcgtactgaagccgtcgcccgaatcgcccctggacgcctatctgctgggc
gagatcgcccgggaggccgggctgccggaaggcgtgctgtcgatcctgccggcggaccgc
gaggtgagcgagtacctggtcgggcaccccgggatcgacaaggtctccttcacgggatcg
gtggccgcgggcaggcgcgtgatggaggtcgcctcccgcaatctcacccgggtgaccctg
gagctgggcggcaagtcggcggcggtggtcctgccggacgcggacatcacgacctcggtg
ccggggatcgtctccgcggcctggatgaacaacgggcaggcctgcgtggcccagacgcgc
atcctcgttccgcgctcgcgctacgacgagttcgcggacgcgttcgcggcggcggcgagc
gccctggtggtcggtgacccgctggacccggcgacccaggtcggcccgctggtggcgagg
cggcagcagcggcgcaacctcgactacatccgcatcggccaggaggagggcgccaagatc
ctgacgggcggcgggcgtccaccgggactcgaccgcggctggtacgtggagccgaccctc
ttcggcgacgtcgacaactccatgcggatcgcgcgggaggagatcttcgggccggtcatc
tgcctgctgccctacggcgacgagaccgaggccgtgaagatcgccaacgactccgactac
gggctgagcggcagtgtctggacggccgacgtggagcacggcatcgacgtcgcacgccgg
gtccgtacgggcacgtactccgtgaacaccttcagcctcgacatgctcggcccgttcggc
ggctacaagaactcgggtctcgggcgggagttcgggcccgaggggtacggcgagttcctg
gagcacaagatgatccacctgccggccgggtacgaggctcccacgggcgtggagggggcc
ggggcctga

DBGET integrated database retrieval system