KEGG   Streptomyces avermitilis: SAVERM_5981Help
Entry
SAVERM_5981       CDS       T00126                                 

Gene name
amyA4
Definition
(GenBank) putative secreted alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
sma  Streptomyces avermitilis
Pathway
sma00500  Starch and sucrose metabolism
sma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sma00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SAVERM_5981 (amyA4)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     SAVERM_5981 (amyA4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Alpha-amylase_C
Motif
Other DBs
NCBI-ProteinID: BAC73693
NITE: SAV5981
UniProt: Q82AS5
LinkDB All DBs
Position
7200765..7202147
Genome map
AA seq 460 aa AA seqDB search
MARKALAVSLALAAGLTVPPAVSPTTAAASPPGTKDVTAVLFEWKFDSVARECTNTLGPA
GYGYVQVSPPAEHIQGSQWWTSYQPVSYKIAGRLGDATAFQNMINTCHTAGVKVVVDTVV
NHMSAGSGTGTGGSAYTKYNYPGLYSSYDMDDCTATITDYTNRANVQNCELVGLADLDTG
EEYVRKTIAGYMNTLLGYGADGFRVDAVKHIPAADLANIKSRLTNPSVYWKQEVIYASGE
AVQPTEYTGNGDVQEFRYAYDLKRVFNNENLAYLKNYGEGWGYLNSSVAGVFVDNHDTER
NGSTLNYKDGANYTLANVFMLAYPYGAPDINSGYEWSDADAGPPGGGTVNACWQDGWKCQ
HAWPEIKAMVAFRNATRGESVTNWWDNGGDAIAFGRGAKGYVAINHESGSLTRTYQTSLT
AGTYCNVQNNTGVTVDSSGRFTATLGANTALALYSGKSTC
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggcaaggaaagcgctcgctgtctcgctcgccctcgcggcgggcctcacggtcccgccc
gccgtctccccgaccactgcggcggcctcgccgcccggcaccaaggacgtcaccgccgtc
ctcttcgagtggaagttcgactcggtcgccagggagtgcaccaacaccctgggcccggcc
ggctacggatacgtccaggtctccccacccgccgagcacatacagggctcgcagtggtgg
acctcgtaccagccggtcagctacaagatcgccgggcggctcggtgacgccaccgccttc
cagaacatgatcaacacctgtcatacggcgggtgtgaaggtcgtcgtcgacacggtcgtc
aaccacatgtcggcgggcagcggcaccggcaccggcggctcggcgtacacgaagtacaac
taccccggcctgtactcctcgtacgacatggacgactgcacggccacgatcaccgactac
accaaccgcgccaacgtccagaactgcgaactcgtcggcctcgccgacctggacacgggc
gaggagtacgtccgcaagaccatcgcgggctatatgaacaccctgctcggctacggcgcc
gacggcttccgtgtcgacgcggtcaagcacatacccgccgccgacctcgccaacatcaag
tcccggctgaccaacccctccgtgtactggaagcaggaggtcatctacgcctccggcgag
gccgtccagcccaccgagtacacgggcaacggcgacgtccaggagttccggtacgcgtac
gacctcaagcgggtcttcaacaacgagaacctcgcctacctgaagaactacggtgagggc
tggggctatctgaacagctcggtcgcgggcgtcttcgtcgacaaccacgacaccgagcgc
aatggctcgacgttgaactacaaggacggggcgaactacaccctcgccaatgtcttcatg
ctggcgtacccgtacggcgcgcccgacatcaactccggctacgagtggtcggacgcggac
gccggtccgccgggcggcggcacggtcaacgcctgctggcaggacggctggaagtgccag
cacgcctggccggagatcaaggcgatggtcgccttccgcaacgcgacccgcggcgagtcg
gtcaccaactggtgggacaacggcggcgacgcgatcgcgttcggccgcggcgccaagggc
tatgtggcgatcaaccacgagtcgggctccctcacccgcacgtaccagacctcgctgacg
gcgggcacgtactgcaacgtccagaacaacaccggtgtcacggtcgacagttccggccgg
ttcacggcgacgctcggcgccaacacggccctcgccctgtactccggcaagagcacctgc
tga

DBGET integrated database retrieval system