KEGG   Streptomyces avermitilis: SAVERM_6626Help
Entry
SAVERM_6626       CDS       T00126                                 

Gene name
idnD
Definition
(GenBank) putative L-idonate 5-dehydrogenase
  KO
K00098  L-idonate 5-dehydrogenase [EC:1.1.1.264]
Organism
sma  Streptomyces avermitilis
Brite
KEGG Orthology (KO) [BR:sma00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SAVERM_6626 (idnD)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.264  L-idonate 5-dehydrogenase
     SAVERM_6626 (idnD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Pyr_redox_2 ThiF
Motif
Other DBs
NCBI-ProteinID: BAC74337
NITE: SAV6626
UniProt: Q828N6
LinkDB All DBs
Position
complement(7926763..7927788)
Genome map
AA seq 341 aa AA seqDB search
MLGCVIHGRGDLRVDELPEPAAGPGQALVAVRYGGVCGSDLHYWRHGGVGDFRLREPMVL
GHEVVGTVLSYGPGAAGPAPGTAVAVHPATPCGVCPECADGRANVCRDTRYLGSAARMPH
VQGGFAARVVVPAAQVRALPEGLDLRRAALAEPLSVALHAVRRAGPVAGRPVLVTGAGPI
GCLVVAAAKAAGAGRVTVTDLLPRALSYAAGVGADDVVRADDPADAGWPDSVDVAVEASG
VAAGLDTCLRLVRRGGVVVQLGMLPPGQTPFAGNLVVSREIELRGAFRFADEFDEALTLL
AREPAFDSLISAVVPLEEAESAFALAADRGEACKVLLDFGV
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgctcggttgtgtgatccacggtcggggcgacctgcgggtcgacgaactgcccgagccg
gccgccggaccggggcaggcgctggtcgccgtccgttacggcggcgtatgcggctccgac
ctgcactactggcggcacggcggagtcggggacttccggctgcgggagccgatggtgctc
gggcacgaggtggtggggacggtcctctcgtacgggcccggggccgccggtcccgcgccg
ggtacggccgtggccgtgcacccggcgacgccgtgcggggtgtgtccggagtgcgcggac
ggccgggcgaacgtgtgccgggacacccgctatctgggcagcgcggcccgtatgccgcac
gtccagggcgggttcgccgcgcgggtcgtggtacccgccgcgcaggtgagggcgctgccg
gaggggctggatctgcggcgggccgcgctcgcggagccgctgtcggtggcgttgcacgcg
gtacggcgggcggggccggtggccggccggccggtgctcgtgacgggggccgggccgatc
gggtgcctggtggtggccgcggcgaaggccgccggagcggggcgggtgacggtgacggat
ctgctgccgcgggcgctgtcgtacgccgccggggtgggcgcggacgacgtcgtacgcgcc
gacgatccggccgacgccgggtggccggactcggtcgacgtggccgtcgaggcgtccggg
gttgccgcgggtcttgacacctgcctgcgcctggtgcggcgtggtggggtggtcgtccag
ctgggcatgctgccgcccggacagacgccgttcgccgggaacctggtggtcagccgggag
atcgaactgcggggagcgttccgcttcgccgacgagttcgacgaggcgctgaccctgctg
gcgcgtgagccggcgttcgactccctgatcagcgcggtggttccgctcgaggaggcggag
tcggcgttcgcgctggccgcggaccgcggtgaggcgtgcaaggtgctgctggacttcggg
gtctga

DBGET integrated database retrieval system