KEGG   Streptomyces avermitilis: SAVERM_7160Help
Entry
SAVERM_7160       CDS       T00126                                 

Definition
(GenBank) putative aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
sma  Streptomyces avermitilis
Pathway
sma00250  Alanine, aspartate and glutamate metabolism
sma00410  beta-Alanine metabolism
sma00640  Propanoate metabolism
sma00650  Butanoate metabolism
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
Module
sma_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SAVERM_7160
   00650 Butanoate metabolism
    SAVERM_7160
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SAVERM_7160
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SAVERM_7160
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sma01007]
    SAVERM_7160
Enzymes [BR:sma01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SAVERM_7160
Amino acid related enzymes [BR:sma01007]
 Aminotransferase (transaminase)
  Class III
   SAVERM_7160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: BAC74871
NITE: SAV7160
UniProt: Q826M2
LinkDB All DBs
Position
complement(8521230..8522489)
Genome map
AA seq 419 aa AA seqDB search
MSALSPHLRQATPVVAVRGEGVHLYGEDGRRYLDFTAGIGVTSTGHCHPRVVAAAQEQAG
TLVHGQYTTVLHPPLRRLVDRLGEVLPAGLDSLFFTNSGSEAVEAALRLARQATGRPNVL
VCHGGFHGRTVAAAAMTTSGTRFRSGFSPLMSGVVVTPFPTAFRYGWDEETATRFALQEL
DYTLRTISSPDDTAAIIVEPVLGEGGYVPATRAFLEGLRERADRHGFVLILDEVQTGVGR
TGRFWGHDHFGVTPDILITAKGLASGFPLSGIAASAELMGKAWPGSQGGTYGANAVACAA
ACATLDVVRDEKLVDNAEAMGARLRAGLAAVAATTPAIGDVRGLGLMLASEFVTEDGGPD
PETAARVQRAAVDEGLLLLLCGAWNQVVRMIPALVIDEAEVDEGLRAWSAAVEVGVPAR
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcactgtcaccgcacctccgccaggccacacccgtcgtcgcggtccggggcgag
ggcgtccatctgtacggcgaggacggccgccgctatctcgacttcaccgcgggcatcggc
gtcaccagcaccgggcactgtcaccccagggtggtcgccgccgcccaggagcaggcgggc
acgctcgtccacggccagtacacgacggtgctgcaccctccgctgcggcgcctggtcgac
cggctcggcgaggtgcttccggccggcctggacagcctgttcttcaccaactccggcagc
gaggccgtcgaggccgccctccggctggcccgtcaggccaccggccgtcccaacgttctg
gtctgtcacggcggcttccacggccgtaccgtggccgccgccgccatgaccacctccggt
acccgcttccgctcgggcttctccccgctgatgagcggagtggtcgtcaccccgttcccg
acggccttccgctacggctgggacgaggagaccgcgacccgcttcgccctccaggaactc
gactacacactccggacgatctcctcccccgacgacacggccgcgatcatcgtcgagccg
gtgctcggcgagggcggatacgtgcccgccacccgcgccttcctcgaagggctgcgcgaa
cgggccgaccgtcacggctttgtgctgatcctcgacgaggtgcagaccggcgtgggccgt
accgggcggttctggggacacgaccacttcggcgtcacgccggacatcctcatcaccgcc
aagggactggccagcggcttccccctgtccgggatcgccgcctccgccgagttgatgggc
aaggcatggccgggctcgcagggcggtacgtacggcgccaacgcggtggcctgcgccgcg
gcgtgcgccaccctcgacgtcgtacgcgacgagaagctggtggacaacgccgaggcgatg
ggcgcacggctgcgcgccgggctggcggcggtggccgcgacgacaccggccatcggggac
gtacggggcctcgggctgatgctggccagcgagttcgtcaccgaggacggcggccccgac
cccgagaccgccgcccgggttcagcgggccgccgtggacgaggggctgctcctgctgctg
tgcggcgcgtggaaccaggtggtgcggatgattcccgcgctggtgatcgacgaggcggag
gtcgacgaaggactgcgggcgtggtccgccgccgtggaagtaggcgtgccggcccgatga

DBGET integrated database retrieval system