KEGG   Streptomyces avermitilis: SAVERM_7479Help
Entry
SAVERM_7479       CDS       T00126                                 

Gene name
bga8
Definition
(GenBank) putative beta-galactosidase, secreted
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
sma  Streptomyces avermitilis
Pathway
sma00052  Galactose metabolism
sma00511  Other glycan degradation
sma00600  Sphingolipid metabolism
sma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sma00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SAVERM_7479 (bga8)
  Lipid metabolism
   00600 Sphingolipid metabolism
    SAVERM_7479 (bga8)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SAVERM_7479 (bga8)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SAVERM_7479 (bga8)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_C Glyco_hydro_2_N DUF4982 Glyco_hydro_2 F5_F8_type_C BetaGal_dom4_5 Cellulase
Motif
Other DBs
NCBI-ProteinID: BAC75190
NITE: SAV7479
UniProt: Q825H8
LinkDB All DBs
Position
8909193..8912285
Genome map
AA seq 1030 aa AA seqDB search
MTVTRRSVLIAGTAAPAAGALTGIGGAPAVASAGAPGRHTVALRDGWRFALVNPGGITDP
TGAYADAADPGHDDSGWREVAVPHDWSIEQTPTTQYGTTSGTGFLPGGLGWYRTAFTLPS
ALAGKRISVEFDGVYMDSYVYCNGTEVGRHPYGYTGFAFDLTDLLHTDGTTENVIAVKVQ
NRLPSSRWYSGSGIYREARLVVTEPVHVRRWGTYVTTPDITEERAVVRVRTTVVDASGAG
SEVQVVSRIVGPDGRTAARTTSTVTVADQGTQTHELTVKKPQLWDFAHPHRYTLETELRV
GGKRTDTHRTTFGIRRVTVDPDEGFHLNGTHAKIRGVDLHHDQGALGAAISIDAVRRQMT
IMKSMGVNAFRTSHNPPSPQMIEVCEELGIVMVVEAFDCWRTGKTRYDYGRFFDEWCEKD
ATEMVLAARNSPAVVLWSIGNEIPDSTSTAGLAMADRIIGAIKAADDTRPLVIGSDKYRN
VPAKGSAADLMLAKLDGLGLNYNTAKSVDALHAAYPHLFLFESESSSETSTRGTYQEPEH
LNTGENHTPGKRATSSYDNNLASWTMSGEYGHKKDRDRKWFAGQFLWSGIDYIGEPTPYD
VFPVKASFFGAVDTAGFPKDMYHLFRSQWTSEPMVHLLPMSWNHQAGDTVEVWAYANVDT
VELFLNGKSLGTRTFDTKKTTDGRTYLETTEATGDDKTVTDGPHPGSYTSPNGSAGKLHL
VWKVPYEPGELKAVARRNGRAVATDVLRTAGAPHAVRLTPDRSALAADGRALCFVTAEIV
DARGVVVPDAEHLLSFAVSGGSLAGVDNGREESAERYQASTRTAFHGKALAIVRSGTKAG
TLKVTARSEGLRTATATVRTTPARSTATTPAAEFRPDHPAAPDSPSADASYSGRPDTLPA
AMLDGDPTTGWSNAFAKSATALLPAFSGARPEDWVSVTWARARAFDRVEVSFTVDATHTR
PASVEVQVGDGDRYTPVSGATVDWATGSDAPTVVTFDAARGARLRLVLTSAHPGAADGAV
RISRLEVPPS
NT seq 3093 nt NT seq  +upstreamnt  +downstreamnt
atgacggtcactcgcagatcggttttgatcgccggtacggccgctccggcggccggcgca
ctcacgggcatcgggggcgcgccggccgtggcctcggccggcgccccgggccgccacacc
gtcgccctccgcgacggctggcgcttcgcgctggtcaaccccggcgggatcaccgacccg
accggcgcgtacgccgacgccgccgaccccggccacgacgactcgggttggcgcgaggtc
gccgtcccgcacgactggagcatcgagcagacgcccaccacgcagtacggcaccacgagc
ggcaccggcttcctgccgggcggcctcggctggtaccgcaccgccttcaccctgccgtcc
gccctcgccggcaagcggatctccgtcgagttcgacggcgtctacatggactcgtacgtc
tactgcaacggcacggaggtcggccgccacccctacggatacaccgggttcgcgttcgac
ctcaccgacctgctgcacaccgacggcaccaccgagaacgtcatcgccgtcaaggtgcag
aaccgactccccagcagccgctggtactcgggcagcggcatctaccgggaggcccggctc
gtggtcaccgagccggtgcatgtgcggcgctggggaacgtacgtcacgacgccggacatc
accgaggagcgggcggtcgtacgggtgcggacgaccgtcgtcgacgcgtcgggtgccggg
agcgaggtccaggtcgtctcccggatcgtcggccccgacggccgtaccgccgcccgtacg
acgtccacggtgaccgtcgctgaccagggcacccagacccatgaactcaccgtgaagaag
ccccagttgtgggacttcgcgcacccgcaccgctacaccctggagaccgaactccgggtc
ggcggcaagcggaccgacacccaccgcaccaccttcggcatccgccgtgtcaccgtcgac
ccggacgagggcttccatctcaacggcacccacgccaagatcaggggcgtcgatctgcac
cacgaccagggcgcgctcggggccgcgatcagcatcgacgccgtacgccgccagatgacc
atcatgaagtccatgggcgtcaacgccttccgcacctcccacaacccgccctcgccccag
atgatcgaggtctgcgaggaactgggcatcgtgatggtggtggaggccttcgactgctgg
cggaccggcaagacgaggtacgactacggccggttcttcgacgagtggtgcgagaaggac
gccaccgagatggtgctcgcggcccgtaactcgcccgccgtggtcctgtggtccatcggc
aacgagatccccgactcgacgtccaccgccgggctcgccatggccgaccgcatcatcggt
gcgatcaaggcggccgacgacacccgcccgctcgtcatcggctcggacaagtaccgcaac
gtcccggccaagggctcggcggccgacctcatgctcgccaagctcgacggactcggcctc
aactacaacaccgccaagtccgtggacgccctgcacgccgcctacccccacctcttcctc
ttcgagtcggagtcgtcgtcggagacctcgacccgtggcacgtaccaggagcccgagcac
ctcaacacgggcgagaaccacacgcccggcaagcgcgcgacctcctcgtacgacaacaac
ctcgcctcctggacgatgagcggcgagtacgggcacaagaaggaccgggaccggaagtgg
ttcgccgggcagttcctgtggtcgggcatcgactacatcggggagcccacgccgtacgac
gtcttcccggtgaaggcgtccttcttcggcgcggtcgacacggccggcttccccaaggac
atgtaccacctgttcaggagccagtggacgagcgagccgatggtccatctgctgcccatg
agctggaaccaccaggcgggcgacacggtcgaggtctgggcgtacgccaacgtcgacacc
gtcgaactgttcctcaacggaaagtccctgggcaccaggacgttcgacaccaagaagacc
accgacggccgtacgtacttggagacgacggaggccaccggcgacgacaagacggtcacc
gacggcccccaccccgggagttacaccagcccgaacggcagcgcgggcaagctccacctc
gtctggaaagtgccctacgaacccggggagctgaaggcggtggcccgccgcaacggcagg
gcggtcgccaccgacgtcctgcggaccgccggtgcgccccacgccgttcgcctcaccccc
gaccgctcggcactggccgccgacggccgggcgctgtgcttcgtgaccgcggagatcgtc
gacgcccgcggtgtggtggtgcccgacgccgagcacctgctctccttcgccgtgagcggc
ggctccctcgccggcgtcgacaacggccgggaggagagcgccgagcgctaccaggcaagc
acgcgaaccgccttccacggcaaggcacttgccatcgtgcgctccggtacgaaggcgggg
accctgaaggtgaccgcacgctcggaaggcctgcgtacggccaccgcgaccgtgcgcacc
acccccgcgcgctccacggcgaccacccccgccgccgagttccggcccgaccacccggcg
gcccccgactcgccctcggccgacgcgagttactccggccgccccgacaccctccccgcg
gccatgctcgacggcgacccgaccaccggctggtccaacgccttcgccaagtcggccacg
gctctgctgcccgccttcagtggcgcccggcccgaggactgggtgtcggtcacctgggcc
cgcgcccgcgccttcgaccgcgtcgaggtgtccttcaccgtcgacgcgacgcacacccgg
cccgcctccgtcgaggtccaggtcggggacggtgaccgctacacgcccgtgtcaggcgcc
accgtggactgggccaccgggtccgacgcgccgaccgtggtcaccttcgacgcggcacgc
ggcgcacggctgcgtctcgtcctgaccagcgcacaccccggcgccgccgacggagcggta
cggatcagccggctggaggtcccgcccagctga

DBGET integrated database retrieval system