KEGG   Serratia marcescens subsp. marcescens Db11: SMDB11_4222Help
Entry
SMDB11_4222       CDS       T03985                                 

Definition
(GenBank) putative secretion protein
  KO
K03543  membrane fusion protein, multidrug efflux system
Organism
smac  Serratia marcescens subsp. marcescens Db11
Brite
KEGG Orthology (KO) [BR:smac00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:smac02000]
    SMDB11_4222
Transporters [BR:smac02000]
 Other Transporters
  Accessory factors involved in transport [TC:8]
   SMDB11_4222
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD_3 HlyD_D23 Biotin_lipoyl_2 HlyD HlyD_2 Biotin_lipoyl DUF4407 Seryl_tRNA_N
Motif
Other DBs
NCBI-ProteinID: CDG14781
LinkDB All DBs
Position
4514914..4515957
Genome map
AA seq 347 aa AA seqDB search
MANKKVAVAVLAVAVITLGLLINKFFIKETQQNTNDAYIRADISRISPQIAGEIAQVLVR
DNQWVKQGELLAVIDPREFNVALAQATAQEQSARARQDDARANLTRQSALIAAAQAERQA
AQAELAFARQEQNRYQRMASSGAGSQQAAQQATTRVHTLSANVAQAEATLKAARNMEQVL
QAKLADSDAELMLARAKKAMAELNLSYTRITAPIGGVIGKNSLRVGEFVKPGDALLAIVP
QDKLYIIANYQETQLENIAHGQSVDIHIDTFPGQTLKGQVDSIAPASGVSFAAVAPENAT
GNFTKIVQRIPVKIVFDINKEHAALLSALRVGMSADVSINTLDGGLQ
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggctaacaagaaagtcgccgtcgccgtattggcggttgctgtcattacgctggggtta
ttaatcaataagttctttattaaagagacacagcagaataccaacgacgcctatattcgc
gccgatatctcgcgtatttctccgcagattgccggtgaaattgcgcaggtgttggtcagg
gacaaccagtgggtcaaacagggggaattgctggcggtgatcgatccgcgtgaattcaac
gtcgcattggcgcaggcgacggcgcaggagcaatccgcccgcgcccgccaggacgacgcc
agggccaacctgacccgacagagcgcgctgatcgccgccgcgcaggcggagcggcaggcg
gcgcaggcggagctggcgtttgcgcgccaggagcagaaccgctaccagagaatggccagc
agcggcgcgggttcacagcaggcggcgcagcaggcgacaacgcgagtgcacacgctttcc
gccaatgtggcgcaggcggaggcgacgcttaaagcggcgcgaaacatggagcaggtgctg
caagccaagctggcggacagcgatgccgagctgatgctggcgcgggcgaagaaagcgatg
gccgagctgaacctgtcttacacccgcatcaccgcgccgatcggcggcgtgatcggcaag
aacagcctgcgggtcggggagttcgtcaaaccgggcgatgcgctgctggccatcgtgccg
caggacaagctgtacatcatcgccaactaccaggaaacccagctggaaaacattgcgcac
gggcagtcggtagacatccatatcgatacctttcccggccaaacgctgaaagggcaggtg
gacagcatcgcgccggcttccggcgtcagtttcgcggccgtggcgccggagaacgccacc
ggcaacttcaccaagatcgttcagcgcatcccggtgaaaattgtatttgatatcaacaaa
gagcacgccgctttgttgagcgccctgcgcgtcggcatgtctgcggacgtcagcatcaat
acgctggacgggggcctgcaatga

DBGET integrated database retrieval system