KEGG   Serratia sp. FGI94: D781_0709Help
Entry
D781_0709         CDS       T02433                                 

Definition
(GenBank) cell division protein FtsI/penicillin-binding protein 2
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
smaf  Serratia sp. FGI94
Pathway
smaf00550  Peptidoglycan biosynthesis
smaf01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:smaf00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    D781_0709
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    D781_0709
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:smaf01011]
    D781_0709
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:smaf03036]
    D781_0709
Enzymes [BR:smaf01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     D781_0709
Peptidoglycan biosynthesis and degradation proteins [BR:smaf01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   D781_0709
Chromosome and associated proteins [BR:smaf03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    D781_0709
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: AGB81056
UniProt: L0MED0
LinkDB All DBs
Position
764682..766445
Genome map
AA seq 587 aa AA seqDB search
MKAARPGKLKRQEDQASFVSWRFALLCGCILLALVGLMLRVAYLQVISPDRLVKEGDMRS
LRVQQVPAARGMISDRAGRPLAVSVPVNAIWADPKELNERGGITLDNRWKALSDALGIPL
DQLSKRINANPRGRFVYLARQVNPAIGEYIHKLKLPGIYLRQESRRYYPAGQVTSHIIGV
TNIDGQGIEGIEKSFDHWLTGQPGKRTVRKDRYGRVIEDISSVDSQAAHNLALSIDERLQ
ALVYRELNNAVAFNKAESGTAVLIDVNTGEVLAMANSPSYNPNNMAGTPKETMRNRAITD
IFEPGSTVKPMVVMTALQHGVVKENSVLNTVPYRINGHEIKDVARYPELSVTGILQKSSN
VGVSKLALAMPSSALVDTYSRFGLGKATNLGLVGESSGIYPKKQRWSDIERATFSFGYGL
MVTPLQLARVYATIGSLGVYRPLSITKVDPPVAGTRVFPEPLVRTVVHMMESVALPGGGG
VKAAIKGYRIAIKTGTAKKVGPDGKYVNRYIAYTAGVAPASQPRFALVVVINDPQGGKYY
GGAISAPVFGAIMGGVLRTMNVEPDALPTGDKSELVINKKEGSGGRS
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcacgccccggtaagttgaagcgccaggaagatcaagccagctttgtcagc
tggcgttttgcgttgctgtgcggctgtattttgctggcgctggtcgggctgatgctgcgg
gtggcgtatctgcaggtcatcagcccggatcggctggtgaaagaaggcgatatgcgttcg
ctgcgcgtacagcaggtgccggcggcacgcggcatgatcagcgaccgcgccgggcggccg
ctggcggtcagcgtaccggtgaacgccatctgggcggatccgaaggagctgaacgagcgc
ggcggcatcacgctggacaaccgttggaaggcgctgtcggatgcgctgggcattccgctc
gatcagctgtccaagcgtatcaacgccaacccgcgcgggcgctttgtctatctggcgcgt
caggttaatccggcgatcggcgagtacattcacaagctgaagctgccggggatttatctg
cggcaggagtcgcgccgctattacccggccggccaggtcacctcgcacattatcggcgtg
accaatattgacggtcagggcattgaaggcattgagaagagtttcgaccactggctgacc
gggcagccgggcaagcgtacggtgcgtaaagaccgttacggccgcgtgattgaggatatc
tcttcggtcgacagccaggcggcgcacaacctggcgctgagcattgatgagcgcctgcag
gcgctggtctaccgcgagctgaataacgcggtggcattcaacaaggcggagtccggcacc
gcggtgctgattgacgtcaacaccggtgaagtgctggcgatggccaacagcccgtcttat
aacccgaacaatatggccggtacgccgaaagagaccatgcgtaaccgtgctattaccgac
atttttgagcctggttccaccgtaaaaccgatggtggtgatgacggcgctgcagcacggg
gtagtgaaagaaaacagcgtgctgaacaccgtgccttaccgcattaacggtcacgagatt
aaagacgtggcgcgttatccggaactgtcggtgaccgggatcttgcagaagtcgagtaac
gtcggcgtttccaagctggcgttagcgatgccgtcctcagcgttagtagatacttactca
cgttttggactgggaaaagcgaccaatttggggttggtcggagaaagcagtggcatatat
ccaaaaaaacaacggtggtctgacatagagagggccaccttctctttcggctacgggcta
atggtaacaccgttacagttggcgcgagtctatgcaacgatcggcagcctgggcgtctat
cgcccgctgtcgattaccaaggttgatccgccggttgccggcacccgggtattccctgaa
ccgctggtgcgcaccgtggtgcacatgatggaaagcgtggccctgccgggcggcggcggc
gtgaaggccgccatcaagggctaccgtatcgccattaaaaccggtaccgcgaagaaagtc
ggcccggacggcaaatacgtcaaccgttatatcgcttataccgccggcgttgcgccggcg
agtcagccccgttttgccctggtggtggtcatcaacgacccgcagggtgggaaatactat
ggtggcgcaatctccgcgccggtgtttggcgccatcatgggcggcgtactgcgcaccatg
aacgttgagccggacgcgttgcccaccggtgataaaagcgaattagtgattaataaaaaa
gagggttcaggtggcagatcgtaa

DBGET integrated database retrieval system