KEGG   Serratia sp. FGI94: D781_0962Help
Entry
D781_0962         CDS       T02433                                 

Definition
(GenBank) exonuclease SbcC
  KO
K03546  DNA repair protein SbcC/Rad50
Organism
smaf  Serratia sp. FGI94
Brite
KEGG Orthology (KO) [BR:smaf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:smaf03400]
    D781_0962
DNA repair and recombination proteins [BR:smaf03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     D781_0962
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_23 SbcCD_C SMC_N AAA_29 cobW AAA_21 ABC_tran NTPase_1 AAA_22 AAA_15 AAA_25
Motif
Other DBs
NCBI-ProteinID: AGB81294
UniProt: L0MBH8
LinkDB All DBs
Position
complement(1021138..1024392)
Genome map
AA seq 1084 aa AA seqDB search
MKILSLRLKNLNSLQGEWKIDFSAEPFASNGLFAITGPTGAGKTTLLDAVCLALYHQTPR
LHVSPSQNDLMTRHTAESLAEVEFEVKGVGYRAFWSQRRAKNDPNGNLQAPKVELALLAD
GKIVADKVRDKLEAVAAITGLDFGRFTKSMMLSQGQFAAFLNADANDRAELLEELTGTEI
YGRLSERVFEQHKQAKLELDALHQRASGIELLSDEQRQQLDTQLEALRQEETTLNQRDEQ
QRQTLGWLQQWQRLHQQRQQGQQRLQVLQQEQEQAEPQLQTLARSEPAERLRPLHNERQR
CRDELQASQQQLTRLDQQLQQQTAQLAPLQQALEQARAEQQKQAEHRQQQQQLIDEQVLP
LDHQIAQLSKSRAELQQNRDEAVRQCGQQQQTLEALRAERAQLATQAEQHQTQLSALTQA
LAAQQQQQSALEAETPLAALRQRLQQLSDLRPTRQQLATLSSLAQQLDQRLTQQRQELLA
GQQQLQQLAPQLEQARQQYQQHKTLQAEVEKTLELEQRIVSLEAERARLQTGAPCPLCGS
TEHPAVTEYQTLNPSASARRLDTLRQQTETLYKSGVELRARHDGLQQQQQRQQQALEQDE
QQLAAHRQRWSTLTAELAFDFDLQESERLQQWLSDCDREEREGQQHLSRHEQAAQAVQQA
KDALSALQSAQQQAQQQTALLNERLTLLDKQYADARQQQQRLQQQWQDNEEQLVAQQRQR
QALFGEQQVAQVREQLRVRQAACELASQQAAERWQQAQEQRERLNGQLAGLQQQLAQQTQ
RAEQAQQRWQQALDASEFTDDAAFQAALLDDGQRQQLQQLKEQLQQRQVEARALLAQAEQ
ALEQHRQQRPPQADEEHADLEALAQQQQALTQQLKTLQLRQGELRNQLTSDAERRGNQQA
LFAQIAQSQRQYDDWSYLNQLIGSKEGDKFRKFAQGLTLDHLVYLANNQLSRLHGRYLLQ
RKNSDALELLVVDTWQADAQRDTRTLSGGESFLVSLALALALSDLVSHKTSIDSLFLDEG
FGTLDAETLDTALDALDSLNASGKTIGVISHVEAMKERIPVQIKVKKVNGLGISRLEPQY
RVEG
NT seq 3255 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattctgagcctgcggctgaaaaacctcaactcgctgcagggcgagtggaaaata
gacttcagcgccgagccgttcgccagcaacggcctgttcgccatcaccggcccgaccggc
gccggcaaaaccaccctgctcgacgccgtctgtctggcgctgtatcaccagacaccgcga
ctgcacgtctcccccagccagaacgatctgatgacgcgccacaccgccgaatcgctggcc
gaggtggagttcgaggtcaagggcgtcggctaccgcgccttctggagccagcgtcgggcc
aaaaacgatccgaacggcaatctgcaggcgccgaaggtcgaactggcgctgctggcggac
ggcaagatcgtcgccgacaaggtgcgcgacaagctggaggcggtcgccgccatcaccggc
ctcgacttcggccgctttaccaaatcgatgatgctgtcgcaggggcagttcgccgccttc
ctcaacgccgacgccaacgaccgcgccgagctgctggaggagttaaccggcaccgaaatc
tacggccggctgtccgagcgggtgttcgaacagcataagcaggccaaactggagctggac
gcgctgcaccagcgcgccagcggcattgagctgctgagtgacgaacagcgccagcagctg
gacacgcagctcgaggcgctgcgtcaggaagagaccacgcttaatcagcgcgatgagcag
cagcggcagacgctgggctggctgcagcagtggcagcgcctgcaccagcagcgacagcaa
ggccagcagcgcttacaggtgctgcagcaggagcaggaacaggccgaaccgcagctgcag
acgctggcgcgcagcgaacccgccgagcggctgcgtccgctgcacaatgagcgccagcgc
tgccgcgatgagctgcaggcgtcgcagcagcagctgacccggctcgaccagcagctacag
caacagaccgcacagctggcgccgctgcagcaggcgctggagcaggcgcgcgccgaacag
cagaaacaggcggagcaccgccagcaacagcagcagttgatcgacgaacaggtgctgccg
ctcgatcaccagatcgcacagctgagcaaaagccgcgctgaactgcagcagaaccgcgac
gaggccgtgcgccagtgcgggcaacaacaacagacgctggaggcgctgcgcgccgaacgc
gcccagctggcgacgcaggccgaacagcatcagacgcagctgagcgccctgacccaggcg
ctcgccgcgcagcagcagcaacagagcgcgctggaggccgaaacgccgctggccgccctg
cgccagcgcctgcagcagctgagcgatctgcgcccgacgcgccaacagctggcgaccctg
tcgtcgctggcgcagcagctcgaccagcggctgacgcagcagcggcaggaactgctcgcc
ggtcagcaacaattgcaacagctggcgccgcagttagagcaggccagacagcagtatcaa
caacataaaactctgcaggcggaggtggaaaaaaccctcgagcttgagcagcgtatcgtc
agcctggaggccgaacgcgcccggctgcagaccggcgcgccctgcccgctgtgcggctcc
accgaacatccggccgtcaccgagtaccagacgctcaatccgtcggccagcgcccggcgt
cttgatacgctgcgccagcagaccgagacgctgtataaaagcggcgtcgaactgcgcgcc
cgtcacgacggcctgcagcagcaacaacagcgccagcagcaggcgctggagcaggacgag
cagcagctggcggcccatcggcagcgctggagcaccctgaccgccgaactggcgtttgat
ttcgatctgcaggagagcgaacgcctgcagcagtggctaagcgactgcgaccgcgaagag
cgggaaggccagcagcacctcagccggcatgagcaggcggcgcaggcggtacagcaggcc
aaagacgcgctgagcgcgctgcagagcgcgcagcagcaggcgcagcagcagacggcgctg
ttgaatgaacgcctgacgctgctggacaaacagtatgccgacgcccggcagcagcaacag
cgtctgcagcagcagtggcaggacaacgaggagcagcttgtcgcccaacaacggcagcgg
caggcgctgtttggcgaacagcaggtggcgcaggtgcgcgaacagctgcgcgtccggcag
gcggcctgcgaactcgccagccagcaggccgccgaacgctggcagcaggcgcaggagcag
cgcgaacgcctgaacggtcagttggcggggctgcagcaacagctggcgcagcaaacgcag
cgcgccgagcaggcgcagcagcgctggcagcaggcgctggacgccagtgaatttaccgat
gacgccgccttccaggccgccctgctggacgatgggcagcgtcagcagctacagcagttg
aaagaacagctgcagcagcgtcaggtggaagcccgcgcgttactggcgcaggccgagcag
gcgctggagcagcaccgacagcagcgcccgccgcaggcggatgaagagcacgccgacctg
gaagcgctggcgcagcagcagcaggcgctgacgcaacagctgaagacgctgcagctgcgt
cagggcgagctgcgcaaccagctcaccagcgacgccgagcgccgcggcaaccagcaggcg
ctgttcgcgcaaatcgcccaaagccagcggcagtatgacgactggagctatctcaaccaa
ctgatcggctcaaaagaaggcgacaagttccgcaagttcgcccaggggctgacgctcgat
cacctggtctatctggcgaacaaccagctcagccgcctgcatggccgctatctgctgcag
cggaaaaacagcgatgcgctggagctgctggtggtggatacctggcaggcggacgcgcag
cgcgatacccgcacgctgtccggcggcgaaagcttcctggtcagcctggcgctggcgttg
gcgctgtccgatctggtgagccataaaaccagcatcgattcgctgttcctcgacgagggc
ttcggtacgctggatgcagagacgctggacaccgcgctggacgcgctcgacagccttaac
gcctccggcaaaaccatcggcgtgatcagtcacgttgaggcgatgaaagagcgcattccg
gtgcagatcaaagtgaagaaggtcaacggcctgggcatcagccggctggagccgcagtac
cgcgtcgagggttaa

DBGET integrated database retrieval system