KEGG   Serratia sp. FGI94: D781_2060Help
Entry
D781_2060         CDS       T02433                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
smaf  Serratia sp. FGI94
Brite
Enzymes [BR:smaf01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     D781_2060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AGB82336
UniProt: L0MI06
LinkDB All DBs
Position
complement(2176619..2177233)
Genome map
AA seq 204 aa AA seqDB search
MGIWRYINKEKAMSFELPALPYAKDALEPHISAETLEYHYGKHHNTYVVNLNNLVKGSEF
EGKTLEEIVKTSTGGVFNNAAQVWNHTFYWHCLSPQGGGEPTGAVADAINQSFGSFAKFK
EEFTKSAVGNFGAGWTWLVKKADGSLAIVNTSNAATPLTGDDKPLLTVDVWEHAYYIDYR
NARPNYLENFWALVNWAFVAENLA
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgggcatctggcgctatatcaataaggagaaagcaatgtcgtttgaattacctgcatta
ccgtacgccaaagacgctctcgaaccgcacatttccgctgaaacactggaataccactac
ggcaagcaccacaacacctacgtggtgaacctgaacaacctggtgaaaggcagcgagttc
gaaggcaaaaccctggaagagatcgtgaaaacctctaccggcggcgtgttcaacaacgcg
gcgcaggtgtggaaccacaccttctactggcactgcctgtcgccgcagggcggcggcgaa
cctaccggcgcggtggctgacgccatcaaccaatccttcggctctttcgccaagttcaaa
gaagagttcaccaaatccgccgtcggcaacttcggcgccggctggacctggctggtgaaa
aaggccgatggctcgctggcgatcgtcaacacctccaacgcggctaccccgctgaccggt
gacgacaaaccgctgctgaccgtggacgtgtgggagcacgcttattacatcgattaccgc
aatgcgcgtcctaactacctggaaaacttctgggcgttggttaactgggcattcgtggcg
gaaaacctggcgtaa

DBGET integrated database retrieval system