KEGG   Serratia sp. FGI94: D781_2448Help
Entry
D781_2448         CDS       T02433                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
smaf  Serratia sp. FGI94
Pathway
smaf00240  Pyrimidine metabolism
smaf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smaf00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    D781_2448
Enzymes [BR:smaf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     D781_2448
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 KdpD AAA_30
Motif
Other DBs
NCBI-ProteinID: AGB82713
UniProt: L0MFP9
LinkDB All DBs
Position
complement(2594927..2595511)
Genome map
AA seq 194 aa AA seqDB search
MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTLVFTAEIDHRFGVGKVSSRIGLSSQAQ
LYNNDTSLYAMINQEHLQQTVHCVLVDESQFLSKAQVEQLCDVVDQLDIPVLCYGLRTDF
LGELFIGSQYLLAWADKLVELKTICHCGRKANMVLRLDEHGRAMQAGAQVVIGGNESYVS
VCRKHYKEAMHTEV
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggctcaactttatttttattactcggcaatgaacgcggggaaatccaccgcgctgttg
caatcttcatataattatcaagaacgtggtatgcgtacgttggtgttcaccgcagagatt
gatcaccgctttggcgtcggtaaggtcagttcgcggatcggtctctcatcgcaggcgcag
ctgtataataatgacacctcgctgtatgccatgattaatcaggaacatctgcagcagact
gtgcactgtgtgctggtggatgagagccagtttctgagcaaagcgcaggttgagcaatta
tgcgacgtggtcgatcagctggatattccggtattgtgctacggactgcgtaccgatttt
ctcggcgagctgtttatcggcagccagtacctgttggcatgggcggataagctggtggag
ctaaaaaccatctgtcactgcggccgcaaggcgaacatggtgctgcggcttgatgagcac
ggcagggcgatgcaggcgggcgctcaggtggtgattggcggtaatgagagctatgtgtcg
gtgtgccgcaagcattacaaagaggcgatgcacaccgaggtgtaa

DBGET integrated database retrieval system