KEGG   Serratia sp. FGI94: D781_4025Help
Entry
D781_4025         CDS       T02433                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
smaf  Serratia sp. FGI94
Pathway
smaf00473  D-Alanine metabolism
smaf01100  Metabolic pathways
smaf01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:smaf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    D781_4025
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    D781_4025
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:smaf01011]
    D781_4025
Enzymes [BR:smaf01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     D781_4025
Peptidoglycan biosynthesis and degradation proteins [BR:smaf01011]
 Precursor biosynthesis
  Racemase
   D781_4025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Orn_Arg_deC_N
Motif
Other DBs
NCBI-ProteinID: AGB84214
UniProt: L0MJW4
LinkDB All DBs
Position
complement(4254185..4255405)
Genome map
AA seq 406 aa AA seqDB search
MRLYHLALIPLLVITACNQSTSPPSSVLSTVPYQRQVVVDNSRLEISKSALEYNIHKIQT
LLGDKTTLCAILKGDAYGHDLSLVTPVMIENNVSCIGVSSNRELKTVRELGFKGRLMRMR
SANEQEMRQAIEYDTEELVGNLDMAKRLDALAAQQGKTLRIHLALNSGGMSRNGLEVSAQ
AGLDEAKTIAQLPHLKIIGIMSHYPQEDAAAVRQDLARFKVQSQQVLAITGLKRDEVMLH
VANTFATLTVPESWLDMVRVGGVFYGDTIASNDYKRVMTFKSSVAAVNHYPKGNTVGYDR
TYTLKRDSVLANIPVGYADGYRRVFSNAGHVLIHGQKVPVLGKTSMNTIMVDVTDVKGVV
SGDEVVLFGKQAGTEITATEVEDISGALFTEMSILWGATNQRVLVD
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttatatcatctggcgttaatacctctgctggtgattactgcctgtaatcaatca
acgagccccccttccagcgtactctcgaccgtaccctatcaacgacaggtggttgttgat
aactctcggttagaaatatctaaaagtgcgctggaatacaatatccataagattcagacg
ctgcttggggataaaacaacgctgtgcgctattttaaaaggtgatgcctatggtcacgat
ctctcgctggtcacgcctgtcatgattgaaaacaatgtctcctgcattggcgtttccagc
aatcgggagttgaaaaccgtgcgtgaactcggctttaagggccgtttaatgcggatgcgc
agtgctaacgagcaggaaatgcgccaggctattgagtatgatacggaagagttggtaggc
aatctggatatggcgaaacgcctggatgctttggccgcccagcaaggtaaaacgttgcgt
atccacctggcacttaattctggcggcatgtcacgtaacgggctggaggtcagtgctcag
gccggcctggatgaagcaaaaacgattgctcaattaccgcacctgaagattatcggcatt
atgtcgcattatccgcaagaggatgcggcggcggtgcgccaagatcttgcccgtttcaag
gtgcagtcccaacaagttctcgctattaccggtctaaaacgcgatgaggtgatgcttcat
gtcgccaataccttcgctacccttaccgtgccggagtcctggcttgatatggtgcgcgtt
ggcggcgtgttttatggcgacaccattgccagtaatgattataaacgcgtgatgacgttt
aagtcctcggtggctgcggttaaccattatccaaaggggaatacggtgggttatgaccgt
acttatacactcaagcgcgattcggtattggctaacattcctgtcggctacgccgatggt
taccgccgggtattcagtaatgccggccatgtcctgattcatgggcagaaggtgccggtg
ttaggtaaaacctcaatgaataccattatggtggacgtaacggatgtgaaaggcgtggtc
tccggggatgaggttgtgctattcggcaagcaagcgggaacggaaattaccgctactgag
gtcgaagatatcagcggcgcgctgttcaccgaaatgtcaattctctggggagccaccaat
cagcgggtgctggtagattaa

DBGET integrated database retrieval system