KEGG   Serratia sp. FGI94: D781_4325Help
Entry
D781_4325         CDS       T02433                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
smaf  Serratia sp. FGI94
Pathway
smaf00400  Phenylalanine, tyrosine and tryptophan biosynthesis
smaf01100  Metabolic pathways
smaf01110  Biosynthesis of secondary metabolites
smaf01130  Biosynthesis of antibiotics
smaf01230  Biosynthesis of amino acids
Module
smaf_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:smaf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    D781_4325
Enzymes [BR:smaf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     D781_4325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 Cytidylate_kin dNK Cytidylate_kin2 AAA AAA_22 AAA_16 TsaE APS_kinase ABC_tran AAA_25 AAA_5 AAA_7 AAA_28 AAA_17 Ploopntkinase3 AAA_24 RNA_helicase AAA_PrkA His_biosynth ATPase_2 AAA_29 Mg_chelatase RsgA_GTPase AAA_14 IstB_IS21 AAA_2
Motif
Other DBs
NCBI-ProteinID: AGB84501
UniProt: L0MP64
LinkDB All DBs
Position
complement(4549344..4549865)
Genome map
AA seq 173 aa AA seqDB search
MAEKRNIFLVGPMGAGKSTIGRQLAQQLNMEFFDSDQEIERRTGADVGWVFDVEGEEGFR
DREEKVINELTEKQGIVLATGGGSVKSRETRNRLSARGVVVYLETTIEKQLARTQRDKKR
PLLQVDEPPREVLEALAKERNPLYEEIADVTIRTDDQSAKVVANQIINMLENN
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaacgcaatatctttctggttgggcctatgggtgccggcaaaagcactatt
ggccgtcagttagctcagcaactcaatatggagttcttcgactccgatcaagaaattgag
cgacgtaccggagctgacgtgggctgggtattcgacgtggaaggcgaagaaggtttccgc
gatcgtgaagaaaaggtcattaatgaactgacggaaaagcaagggattgtgctggcgacc
ggcggtggttcggtgaaatcgcgtgagacgcgtaaccgtctgtcggcgcgaggtgtcgtt
gtttatttggaaaccaccatcgaaaaacagttggcgcgtacccagcgtgataaaaagcgt
ccgctgctgcaggtcgatgagccgccgcgtgaggtgttggaagcgctggcaaaggaacgc
aatccgttgtacgaagaaattgccgatgtcactatccgtaccgacgatcaaagcgctaaa
gtagttgccaaccagattatcaatatgctggaaaacaactga

DBGET integrated database retrieval system