KEGG   Sphingopyxis macrogoltabida EY-1: AN936_12615Help
Entry
AN936_12615       CDS       T04104                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
smag  Sphingopyxis macrogoltabida EY-1
Pathway
smag00473  D-Alanine metabolism
smag00550  Peptidoglycan biosynthesis
smag01100  Metabolic pathways
smag01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:smag00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AN936_12615
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AN936_12615
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    AN936_12615
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:smag01011]
    AN936_12615
Enzymes [BR:smag01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AN936_12615
Peptidoglycan biosynthesis and degradation proteins [BR:smag01011]
 Precursor biosynthesis
  Amino acid ligase
   AN936_12615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: ALH81178
UniProt: A0A0N9V9X0
LinkDB All DBs
Position
complement(2655556..2656482)
Genome map
AA seq 308 aa AA seqDB search
MSRGPWHVAVLMGGWSAEREVSLMSGKGVADALESRGHKVTRIDMDRDVALRLAEAKPDV
VFNALHGVPGEDGTVQGMLDLMGLKYTHSGLVTSVIAIDKELTKQALVPHGIPMPTGTMV
DSESLFSIDPLPRPYVLKPVNEGSSVGVAIVRDDSNYGNPIARDAVGPWQEFDRLLAEPF
IKGRELTVAVLADTPLAVTELRVKSGFYNYDAKYTDGLTEHVCPADVPEDVAQRMKDLAL
QAHRLLGCKGASRSDFRWDDEHGLAGIFLLEVNTQPGMTPLSLVPEQGRAVGMDYAELVE
RIVGEALS
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtgagccggggtccgtggcatgtggctgtcctgatgggcggctggtcggcagagcgcgaa
gtgtcgctgatgagcggcaaaggcgttgccgacgcactcgaaagtcgcggccacaaggtc
acgcgcatcgacatggaccgcgacgtcgctttgcggctggccgaggcgaaacccgacgtc
gtgttcaatgcgctccacggcgtcccgggcgaggacggaacggtgcagggcatgctcgac
ctgatggggctcaaatatacccacagcgggctcgtcacctcggtgatcgcgatcgacaag
gaattgacgaagcaggcgctcgtcccgcatggtatccccatgccgacggggacgatggtc
gacagtgaaagcctcttctcgatcgacccgctgccgcgcccctatgttctgaagccggtc
aacgaaggctcttcggtcggcgtcgcgatcgtccgggacgacagcaattacggcaacccg
atcgcgcgcgacgccgtcgggccgtggcaggaattcgaccgcctgctcgccgaacccttc
atcaaggggcgcgaactgaccgtcgcggtgctcgccgatacgccactcgccgtcaccgaa
ttgcgggtgaagtcgggcttctataactatgacgccaaatataccgacggcctgaccgag
catgtgtgcccggcggacgtgcccgaagatgtcgcgcagcggatgaaggacctcgcgctg
caggcgcatcgtctgctcggctgcaagggcgcgtcgcgctccgacttccgctgggacgac
gaacatggcctcgcgggtatctttctgctcgaggtcaatacccagcccggcatgacgccg
ctcagtctggtgcccgaacaggggcgcgccgtcggcatggattatgccgaactcgtcgaa
cgcatcgtgggggaagcgttgtcatga

DBGET integrated database retrieval system