KEGG   Sphingopyxis macrogoltabida EY-1: AN936_15245Help
Entry
AN936_15245       CDS       T04104                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
smag  Sphingopyxis macrogoltabida EY-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ALH81659
UniProt: A0A0N7GSU1
LinkDB All DBs
Position
complement(3231023..3232507)
Genome map
AA seq 494 aa AA seqDB search
MIGQANAQVAHPDRLFIGGRWIPVEGSGRFTVTNPATEEAFGEVVAAGAPEVERAVAAAR
KAFDEGPWPRMSAAERATYMRALSQALQRRGAALDSAWISQVGVPIWMAQGSGAGTAGLL
DYYAGLAEAYPFEDVRPSNGMMSKVAVVVREPVGVVAAIAPWNGPLASLLIKLAPALATG
CTVILKPAPETPLEAFMLAEAAEEAGFPEGVINLLPADREASDLLVRHPGIDKVAFTGST
EVGLHIAQVCAGRMARFTMELGGKSAAIVLDDFEPEAMGPALAPMITLLCGQVCINFSRV
LVPRARKDAYVESLAAAMAATSIGDPLDANTMMGPLAMARHHAKVSSYFDKGVAEGARIA
TGGRRPPALNSGYYVEPTVFADATNDMAIAQEEIFGPVTAVIPYDSVEEAIAIANDSPFG
LSGGVYTHDTDRAYGVARRIRTGHFTQNGRDFDLTNPFGGFKKSGVGREGGPEGIEPFTE
VKTVFLPQAPGTLA
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgatcggccaagccaacgcgcaggtggcgcatcccgaccggcttttcatcggcggacgc
tggattcccgtcgagggcagcgggcgcttcacggtgaccaaccccgcgaccgaggaagcc
ttcggcgaagtcgtcgctgccggcgcgcccgaggtcgaacgcgccgtcgctgcggcacgc
aaggcgttcgacgagggaccctggccgcggatgtcggccgccgaacgcgcgacctatatg
cgcgcgctgtcgcaggcactgcagcgtcgcggcgccgcgctcgacagcgcgtggatatcg
caggtcggggtgccgatctggatggcgcagggctcgggtgcgggcacggcagggctgctc
gactattatgccgggctcgccgaggcatatccgttcgaggatgtgcgtccgtcgaacggc
atgatgtcgaaggttgcggtggtggtgcgcgagccggtcggcgtcgtcgctgcgatcgcg
ccgtggaacgggccgctcgcttcgttgctgatcaagctggcgcccgcgctcgcgaccgga
tgcactgtcatcctgaagcccgcccccgaaaccccgctggaggcgttcatgctcgccgaa
gccgccgaggaggcgggtttccctgagggggtaatcaacctgctgcccgccgaccgcgag
gcatcggacctgctcgtccgccatcccggcatcgataaagtcgccttcacgggctcgacc
gaggtagggctgcatatcgcccaggtctgcgccgggcgcatggcgcgcttcacgatggag
ctcggcggcaagtcggcggcgatcgtgctcgacgatttcgagcccgaggcgatgggtccc
gcgctcgcgccgatgatcaccctgctgtgcggccaggtgtgcatcaatttcagccgcgtg
ctcgtcccgcgcgcacgcaaggatgcctacgtcgaaagccttgccgccgcgatggcagcg
accagcatcggcgacccactcgacgcgaacacgatgatgggcccgctcgcgatggcacgg
caccatgccaaggtgtcgagctatttcgacaagggcgttgccgagggtgcgcgcatcgcg
accggcggccgccgcccgcccgcgctcaacagcggctattatgtcgaaccgacggtgttc
gccgacgcgaccaacgacatggcgatcgcacaggaggaaatcttcggccctgtcactgcg
gtcatcccctatgacagcgtcgaggaagcgatcgccatcgccaacgacagtccgttcggc
ctgtcgggcggcgtctacacccacgacaccgaccgcgcctatggcgtcgcgcggcgcatc
cgcaccggccatttcacccagaacggccgcgatttcgacctgaccaacccgttcggcggc
ttcaagaaatcgggcgtcggacgcgagggcggacccgaggggatcgaaccctttaccgag
gtcaagaccgttttcctgccgcaggcgcccggcacgctcgcatga

DBGET integrated database retrieval system