KEGG   Sphingopyxis macrogoltabida EY-1: AN936_15780Help
Entry
AN936_15780       CDS       T04104                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
smag  Sphingopyxis macrogoltabida EY-1
Brite
KEGG Orthology (KO) [BR:smag00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AN936_15780
Enzymes [BR:smag01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AN936_15780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_oxidored FAD_binding_2 Thioredoxin_3 HI0933_like AlaDh_PNT_C FAD_binding_3 NAD_binding_8 DAO NAD_binding_7 K_oxygenase Thi4 Glutaredoxin FMO-like
Motif
Other DBs
NCBI-ProteinID: ALH81762
UniProt: A0A0N9UEC5
LinkDB All DBs
Position
complement(3360911..3362494)
Genome map
AA seq 527 aa AA seqDB search
MLDANLKQQLQGLLTNLREPIELVSSLGDDAKSAELADLLDEIAALSDMVSVERADDDAR
RPSFLIRRASDAQVAVRFAGIPLGHEFTSLVLALLQVGGHPPKVAPEVLEQVAALDGDYH
FETYFSLSCQNCPDIVQALNLMSVVNPRITHTAIDGGLFQAEVEDRKIMAVPTIFLNGEN
FGQGRMELEQILAKLDSGAEAKAAEKIAAKEAFDVLVVGGGPAGAAAAIYAARKGIRTGI
AAERFGGQVLDTMAIENFISVQHTEGPKLVAQLEQHVKDYDVDIMNLQLAEKLIPAKVEG
GLHEVKLASGASLKARTVILSTGARWRQLGVPGEDAYRNKGVAYCPHCDGPLYKGKRVAV
IGGGNSGVEAAIDLAGLVAHVTLIEYDSELRADAVLRRKLASLPNVMIITSALTTEVLGD
GEKVTGLSYKDRNKDELHQIELEGIFVQIGLVPNTEWLKDSVTLSRHGEIEVDHRGETSQ
KGVFAAGDCTTVPYKQIVIAMGEGSKAALSAFDYMIRLPAEVEAAAA
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccaatctgaagcagcagcttcaaggcctcctcacgaaccttcgtgaaccg
atcgaactcgtctcgtcactcggcgacgatgccaagtcggccgagcttgcggatcttctc
gacgaaatcgccgcactgtcggacatggtcagcgtggaacgcgccgacgacgatgcgcgc
cgcccgagcttcctgatccgccgcgccagcgacgcgcaggtcgccgtgcgcttcgcgggc
attccgctcggccatgaattcacctcgctcgtcctcgcgctgctccaggtcggcggccat
ccgccgaaggtcgcgcccgaggtgctggagcaggtcgcggcgctggatggcgactatcac
ttcgaaacctatttctcgctgtcgtgccagaactgccccgacatcgtgcaggcgctcaac
ctgatgagtgtcgtcaacccgcgcatcacgcacactgcgatcgacggcggactgttccag
gccgaggtcgaggatcgcaagatcatggcggtgccgacgatcttcctcaacggcgagaat
ttcggtcagggccggatggagctcgaacagattctcgcgaagctcgacagcggcgccgag
gccaaggcggccgagaagatcgccgcgaaggaggcgttcgatgtgctcgtcgtcggcggc
ggcccggcgggcgccgcggccgcgatctatgcggcgcgcaagggcatccgcaccggcatc
gccgccgagcgcttcggcgggcaggtgctcgacacgatggcgatcgagaatttcatctcg
gtccagcacaccgaggggccgaagctcgtcgcgcagctcgaacagcacgtcaaagactat
gacgtcgacatcatgaacctgcagcttgccgaaaagctcatcccggcgaaggtcgaaggc
ggcctccacgaggtgaagcttgcgagcggcgcgtcgctgaaggcgcgcaccgtgatcctc
tcgaccggcgcgcgctggcgccagctcggcgtgccgggcgaggatgcctatcgtaacaag
ggcgtggcctactgcccgcactgcgacggcccgctttacaagggcaagcgcgtcgcggtg
atcggcggcggcaacagcggcgtcgaggcggcgatcgacctcgcgggtctcgtcgcgcat
gtcacgttgatcgagtatgacagcgagctgcgcgccgacgcggtgttgcggcgcaagctc
gcgagcctgcccaacgtcatgatcatcacctcggcgctgaccaccgaagtgctgggcgac
ggcgagaaggtgacggggctcagctacaaggaccgcaacaaggacgaactgcaccagatc
gaactcgaaggcattttcgtccagatcggcctcgtcccgaacaccgaatggctgaaggat
agcgtcactttgtcgcggcatggcgagatcgaggtcgaccatcgcggcgagacgagccag
aagggcgttttcgcggcgggcgactgcacgacggtgccgtacaagcagatcgtcatcgcg
atgggtgaagggtcgaaggcggcgctgtcggcgttcgactatatgatccgcctgccggcc
gaggtggaagccgcggcagcgtga

DBGET integrated database retrieval system