KEGG   Sphingopyxis macrogoltabida EY-1: AN936_22145Help
Entry
AN936_22145       CDS       T04104                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
smag  Sphingopyxis macrogoltabida EY-1
Pathway
smag00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:smag00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AN936_22145
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:smag02000]
    AN936_22145
Enzymes [BR:smag01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AN936_22145
Transporters [BR:smag02000]
 Other Transporters
  Pores ion channels [TC:1]
   AN936_22145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_C
Motif
Other DBs
NCBI-ProteinID: ALH82956
UniProt: A0A0N9USL0
LinkDB All DBs
Position
complement(4683431..4684066)
Genome map
AA seq 211 aa AA seqDB search
MAEDLIFYTNPMSRGQIVRWMLEEVGAPYEPRILDYGTTMKGAAYLAVNPMGKVPAIVHN
GKAITECAAICAYLADAFPAAGLAPAPADRADYYRWLFFTAGPVEQAITAKHFGIEPDVD
QQRMAGFGSLAAALDTLESAVADKAFVAGDRFTAADVYVGSQIDWGLQFGTIPSRPAFET
YVAPLRERAAYKRAKEIDNGLIAEMQAANPA
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagatttgattttctataccaaccctatgtcgcgcggccagatcgtgcgctgg
atgctcgaagaggtcggcgcaccctatgagccgcgcattctcgattatggcacgaccatg
aagggcgccgcctatctcgcggtcaatccgatgggcaaggtgccggcgatcgtccacaac
ggcaaggcgatcaccgaatgcgctgcaatctgcgcctatctcgccgacgccttccccgct
gcggggctcgcgccggcgcccgccgaccgcgccgactattatcgctggctattcttcacc
gccgggcccgtcgaacaggcgatcaccgccaagcatttcgggatcgaacccgatgtcgac
caacagcggatggcgggcttcggctcgctcgccgcggcgctcgacacgctcgaaagcgcg
gtcgcggacaaggccttcgtcgcgggcgaccgcttcaccgccgccgacgtctatgtcggc
agccagatcgactgggggctgcaattcggcaccatcccgtcacgcccggcgttcgagacc
tatgtcgcgccgctgcgcgaacgcgcggcctacaagcgcgccaaggaaatcgacaacggc
ctgatcgccgagatgcaggcggcgaacccggcgtga

DBGET integrated database retrieval system