KEGG   Sphingopyxis macrogoltabida EY-1: AN936_23415Help
Entry
AN936_23415       CDS       T04104                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
smag  Sphingopyxis macrogoltabida EY-1
Brite
Enzymes [BR:smag01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AN936_23415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C
Motif
Other DBs
NCBI-ProteinID: ALH83098
UniProt: A0A0N9VFG2
LinkDB All DBs
Position
p1:87591..88322
Genome map
AA seq 243 aa AA seqDB search
MTIDHLSRRSAIATLGIGAAAMTINEASAQTPAAAPAAVPAFAGNHQVKPLRFNPARLHG
LSERLITSHHENNYAGSVKALNMIETRLAAALADTDLPPVVYGGLKREELHRTGSVVLHE
VYFDGLGGNGQAAGSIRDALGAAFGSFDRWEADFRRTGMSLAGGSGWCVLVYNLHTRSLH
NHWAWDHMHGAIAGVPLLALDMYEHSFHMDYGTAAAKYVDAFFRNIDWEVVDRRYAAALR
GGG
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
gtgacgatcgaccatctttcccgacgcagtgcaatcgcaactcttggcatcggagccgcc
gccatgactatcaacgaagcctctgcgcagacgccggccgcagcgccggcggctgtcccc
gcctttgccggaaatcatcaggtcaagccgctcaggttcaatcccgccaggcttcacggc
ctctccgaaaggctgatcacatcgcaccacgagaacaattatgcgggctcggtcaaggcc
ctgaatatgatcgagacacgacttgccgccgcgctcgctgacacggacctgccgccggtg
gtctatggcggattgaagcgcgaggagctgcaccgcaccggctcggtcgtgctccatgag
gtctatttcgacgggctcggcggcaacggccaggcagccggttccatccgcgacgcgctg
ggcgcggcgttcggctcgttcgaccgctgggaagccgacttccgccgtaccgggatgagc
cttgccggcggatcgggctggtgcgtgctcgtctacaatctccacacgcgctcgctgcac
aaccattgggcgtgggatcatatgcacggtgcgattgccggcgtgccgctgctcgcgctc
gatatgtacgagcacagtttccacatggattacggcaccgccgccgccaaatatgtcgac
gccttcttccgcaacatcgactgggaagtggtcgaccggcgctatgccgcggctttgcgc
ggcggcggctga

DBGET integrated database retrieval system