KEGG   Shewanella maritima: EXU30_00820Help
Entry
EXU30_00820       CDS       T06365                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
smai  Shewanella maritima
Pathway
smai00020  Citrate cycle (TCA cycle)
smai00190  Oxidative phosphorylation
smai00650  Butanoate metabolism
smai01100  Metabolic pathways
smai01110  Biosynthesis of secondary metabolites
smai01120  Microbial metabolism in diverse environments
smai01200  Carbon metabolism
Module
smai_M00009  Citrate cycle (TCA cycle, Krebs cycle)
smai_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
smai_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:smai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EXU30_00820
   00650 Butanoate metabolism
    EXU30_00820
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    EXU30_00820
Enzymes [BR:smai01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     EXU30_00820
    1.3.5.4  fumarate reductase (quinol)
     EXU30_00820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA HI0933_like Pyr_redox_2 FAD_binding_3 DAO Thi4
Motif
Other DBs
NCBI-ProteinID: QBF81400
UniProt: A0A411PDF1
LinkDB All DBs
Position
complement(164061..165827)
Genome map
AA seq 588 aa AA seqDB search
MSIPVREFDAIVIGAGGAGMRAALQISKEGKSCALLSKVFPTRSHTVSAQGGITVALGNA
HEDHWEQHMYDTVKGSDFIGDQDAIEFMCQTGPEAIIELEHMGLPFSRFDNGKIYQRPFG
GQSKNFGGEQAARTAAAADRTGHALLHCLYQQNVKHKTEVFSEWYALDLVKNEDGVIVGC
TAIEIETGEIVYFKAKATVLATGGAGRIYASTTNAHINTGDGVGMAMRAGVQMQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKDGERFMERYAPNAKDLASRDVVARSMMTEIREG
RGLDGPLGPHCLLKLDHLGKETLEARLPGVCELSRTFAHIDPADGPIPVLPTCHYMMGGL
PSKVSGQVIRQNEDGSEQDVTGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRAAGQHLG
KALDETPTPKDATAENIEASLARLNRWESNQDGEDPAEIRKDLQLCMQLNFSVFRTGEAM
AEGLKQLKAIQKRLDNAKLSDNSREFNTQRIECLELDNLMATALATAYAANFRTESRGAH
SREDFLERDDDNWLCHSIFDPASESMKKRDVNMEPKLREAFPPKKRTY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
gtgagtattccagttcgcgaatttgacgcaatcgtaattggtgctggtggtgcaggtatg
cgcgcagcactgcagatttctaaagaaggtaagagctgtgcgcttttatctaaagtattc
ccaactcgttctcatacagtatctgctcagggcggtatcacggttgcattaggtaatgcc
catgaagaccactgggaacagcacatgtatgacactgttaaaggctcagactttattggt
gatcaggacgcaattgaattcatgtgtcaaaccggccctgaagccattattgagcttgag
cacatgggtttacctttctcacgttttgacaatggtaagatttatcaacgtccattcggt
ggtcagtctaaaaactttggtggcgaacaggctgctcgtactgcagcggctgctgaccgt
actggtcacgctttacttcactgtctttaccagcaaaacgtaaagcataaaaccgaagtg
ttttcagaatggtacgcgctagatttagtaaaaaatgaagacggcgtaatcgtaggttgt
accgcgatcgaaatcgaaacgggtgagatcgtttacttcaaagctaaagctacagtatta
gcaactggtggtgcagggcgtatctacgcttctactactaacgctcacattaacactggt
gacggtgtcggtatggcgatgcgcgctggcgtgcaaatgcaagacatggaaatgtggcag
ttccacccaacgggtattgctggtgctggtgtacttgttaccgaaggttgtcgtggtgaa
ggtggttatctactaaataaagatggcgagcgtttcatggagcgttacgcaccaaatgct
aaagacttagcatcgcgtgacgttgtagctcgttcgatgatgacagaaatccgcgaaggt
cgcggcttagatggcccattaggcccacactgtctgcttaaacttgaccacctaggtaaa
gaaacgcttgaagctcgtcttcctggtgtttgtgaactttctcgtacgtttgctcatatt
gaccctgcagacggtccaattcctgtacttcctacctgtcactacatgatgggtggctta
ccatctaaggtaagcggtcaggttatccgtcaaaatgaagatggcagcgagcaagatgtg
actggtttattcgcagtaggtgagattgcctgtgtatcagtgcacggtgctaaccgccta
ggtggtaactcactgcttgaccttgtggtatttggacgagcagctggtcagcacttaggt
aaagcgttagatgaaacgccaacgcctaaagatgcaacggctgaaaacattgaagcttct
ttagcacgtttaaatcgttgggagtcaaaccaagacggtgaagacccggctgaaattcgt
aaagatctgcaactttgtatgcagctaaacttctcagtattccgtactggtgaagcgatg
gctgaaggtcttaagcagctaaaagcgattcaaaagcgtctagacaacgctaagttatct
gacaactctcgcgagtttaacactcaacgtatcgagtgtttagagttagacaacttgatg
gcgacagcactcgcaacggcatacgctgctaacttccgtactgaaagtcgtggtgcgcat
tcacgtgaagacttcttagagcgtgacgatgacaactggttatgtcactcaatctttgac
ccagcatctgagtcaatgaagaagcgcgatgtgaacatggagccaaagcttcgcgaagct
ttccctcctaagaaacgtacctactaa

DBGET integrated database retrieval system