KEGG   Shewanella maritima: EXU30_02190
Entry
EXU30_02190       CDS       T06365                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
smai  Shewanella maritima
Pathway
smai00473  D-Alanine metabolism
smai00550  Peptidoglycan biosynthesis
smai01100  Metabolic pathways
smai01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:smai00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    EXU30_02190
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EXU30_02190
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    EXU30_02190
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:smai01011]
    EXU30_02190
Enzymes [BR:smai01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     EXU30_02190
Peptidoglycan biosynthesis and degradation proteins [BR:smai01011]
 Precursor biosynthesis
  Amino acid ligase
   EXU30_02190
SSDB
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2
Other DBs
NCBI-ProteinID: QBF81632
UniProt: A0A411PDV1
LinkDB
Position
505182..506189
AA seq 335 aa
MSKINVLLLCGGGGAEHDISLLSAKFFETTLENIPEYQVQKVELNKQGQYITSDGEICEL
TGERQLRHVAEPSKNWPIDFVIPCIHGYPGETGDIQSYFELIGLPYFGCDAEASRNSFNK
VTAKMWFSALGIPNTPYLFLHQLDDQAISETQAAFDKWGSVFVKAASQGSSVGCYKVDNR
DDIANVLKDAFKYSPYVVVEKTIVARELEVAAYEYQGEVIASKPGEIICDSNSFYTFDEK
YAADSKASTKVEADNLTAEQLAKIQAYSIKAFKGMKLRHLSRIDFFLTEDGEILLNEINT
FPGSTPISMFPKMLAHNGHDYGEFLKDAVTRALNS
NT seq 1008 nt   +upstreamnt  +downstreamnt
atgtcgaaaatcaatgtattgttattgtgcggtggcggcggcgctgagcacgatatttcc
cttctttcagccaagttttttgaaacaacgctcgaaaacattcctgaataccaggtacaa
aaggttgaactaaataagcaagggcaatacatcacgtcagatggtgagatttgtgagctt
actggcgagcgtcaattgagacacgttgcagagccatcaaaaaactggccaattgatttt
gttatcccatgtattcacggctatccgggcgaaactggcgatattcaatcttactttgag
ctgattggcctaccttactttggttgtgacgcagaagcatcacgaaacagcttcaacaag
gtcaccgcaaaaatgtggtttagcgctcttggcattcctaacacgccttacctatttcta
catcaactcgatgaccaagccattagcgaaacccaagcagcctttgataaatggggctct
gtgtttgtaaaagccgcgtcacaaggctcatctgtaggttgctacaaggtcgataaccgc
gatgatatcgcaaatgtacttaaagacgcgtttaagtattcaccttatgtggtggttgag
aaaaccattgttgctcgtgagctagaagtcgccgcatatgaatatcaaggtgaagtgatt
gccagcaagccaggcgaaatcatttgcgatagcaactcattttatacctttgatgagaaa
tatgccgcagatagcaaggcaagcactaaagttgaagctgacaacctaaccgccgaacag
cttgccaaaatacaagcatactcaatcaaagcctttaaaggcatgaagctacgtcacctg
tcacgtatcgatttcttcttaaccgaagacggtgaaattttgctaaatgaaatcaacacc
ttcccaggctcaaccccgatttccatgttccccaaaatgctagcgcacaatggccatgac
tatggtgagttcttaaaagatgccgtaacgagagcgttgaactcataa

DBGET integrated database retrieval system