KEGG   Streptomyces malaysiensis: SMALA_0919Help
Entry
SMALA_0919        CDS       T05189                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase class-III
  KO
K00596  2,2-dialkylglycine decarboxylase (pyruvate) [EC:4.1.1.64]
Organism
smal  Streptomyces malaysiensis
Brite
KEGG Orthology (KO) [BR:smal00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:smal01007]
    SMALA_0919
Enzymes [BR:smal01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.64  2,2-dialkylglycine decarboxylase (pyruvate)
     SMALA_0919
Amino acid related enzymes [BR:smal01007]
 Aminotransferase (transaminase)
  Class III
   SMALA_0919
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ATL81154
UniProt: A0A291SJV0
LinkDB All DBs
Position
complement(1303650..1304963)
Genome map
AA seq 437 aa AA seqDB search
MDPETAGGAAERHLIRYSGKAAFTSEVIARAAGTSVFTESGRELLDFTSGQMSAILGHSH
PAIVATVREQVAHLDHLHSGMLSRPVIDLSRRLAESLPDPLEKALLLTTGAEANEAAVRM
AKLVTGRHEVVSFARSWHGMTQAAANATYSAGRKGYGPAAPGNFALPVPDRFHPEIVDAD
GSLDWRRQLDMGFDLIDAQSVGSLAACLVEPILSSGGVIELPPGYLAALARKCRERDMLL
ILDEAQTGLCRTGDWYAFEAEGVVPDILTLSKTLGAGLPLAAVLTSAEIEQRAHDLGFLF
FTTHVSDPLPAAVGNTVLDVLVRDHLDKRARDLGAALRDGLDELATRHEVIGDVRGRGLL
LGVELVGDQVLGEGGADRLGAAVTRRCFDLGLHMNIVQLPGMGGTFRIAPPLTASDDEIA
RGVAILDQALTDAVRGL
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggatcccgagactgccggtggcgccgccgagcgccacctcatccgctattccggcaaa
gccgcgttcacctccgaggtcatcgcccgcgccgcgggcacatcggtgttcaccgagagc
ggtcgtgagctgctcgacttcacctccggccagatgagtgcgatcctcggccactcccac
ccggcgatcgtggcgacggtgcgcgagcaggtggcccacctcgaccatctgcacagcggc
atgctcagccgcccggtcatcgacctcagccgccggctcgccgagtccctgcccgacccc
ctggagaaggcgctgctcctgaccaccggggcggaggcgaacgaggccgcggtgcggatg
gccaaactcgtcaccggccgccatgaggtcgtctcgttcgcccggtcctggcacgggatg
acccaggccgccgcgaacgccacctacagcgccgggcgcaagggctacggacccgccgcg
ccgggcaacttcgcgctgcccgtcccggaccgcttccaccccgagatcgtggacgccgac
ggctcgctcgactggcgccgccagctcgacatgggcttcgacctgatcgacgcccagtcg
gtcggcagtctcgccgcctgtctggtcgagccgatcctcagctccggtggcgtcatcgaa
ctcccaccgggctatctcgccgccctggcccggaagtgccgggagcgggacatgctgctg
atcctcgacgaggcccagaccgggctgtgccgtaccggcgactggtacgccttcgaggcc
gagggcgtcgtcccggacatcctcacgctgtccaagacgctcggcgcggggctgccgctg
gccgccgtgctgaccagcgcggagatcgagcagcgggcgcacgacctggggttcctgttc
ttcaccacccatgtcagcgacccgctgccggccgccgtcggcaacaccgtcctggacgtc
ctggtccgcgaccacctcgacaagcgtgcgcgcgacctcggcgcggcactgcgcgatggg
ctcgatgaactcgccacccgacacgaggtcatcggggacgtccgcggccggggcctgctg
ctgggcgtggagctggtgggcgatcaggtactgggcgaaggcggcgccgaccggctcggc
gcggccgtcacccggcgctgcttcgacctcgggctgcatatgaacatcgtccagttgccc
ggcatgggcggcaccttccggatcgcgcccccgctgaccgcgagcgatgacgaaatcgcc
cgcggtgtcgccatcctcgaccaggcgctcaccgacgccgtccgggggctctga

DBGET integrated database retrieval system