KEGG   Streptomyces malaysiensis: SMALA_1217
Entry
SMALA_1217        CDS       T05189                                 

Definition
(GenBank) alpha/beta hydrolase
  KO
K10216  2-hydroxymuconate-semialdehyde hydrolase [EC:3.7.1.9]
Organism
smal  Streptomyces malaysiensis
Pathway
smal00362  Benzoate degradation
smal00622  Xylene degradation
smal00643  Styrene degradation
smal01100  Metabolic pathways
smal01120  Microbial metabolism in diverse environments
smal01220  Degradation of aromatic compounds
Module
smal_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:smal00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SMALA_1217
   00622 Xylene degradation
    SMALA_1217
   00643 Styrene degradation
    SMALA_1217
Enzymes [BR:smal01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.9  2-hydroxymuconate-6-semialdehyde hydrolase
     SMALA_1217
SSDB
Motif
Pfam: Abhydrolase_6 Abhydrolase_1 Hydrolase_4 Peptidase_S9 Abhydrolase_4 Esterase DLH YAcAr
Other DBs
NCBI-ProteinID: ATL81452
UniProt: A0A291SKN1
LinkDB
Position
complement(1641024..1641770)
AA seq 248 aa
MVLLHGGGPGVDAVSNWAAVRPRLSAEFRCLAPDLLGFGTRITGGEAGAGGLHGPRAWAR
ARARQVLDLLDRHGLERVHLVGNSAAGGAAALALMAEAPERIGRAVLMGGAGTGPLPRAV
PFYDQPTRESMRATLGRLVADESAHRELLDDLTDLRLEQALRPGAEAAFRSMFVDAADGP
PPVDPARVTAPVLALHGECDRVAPADVSARLVQALPRGRLHVVPGAGHWIHVDRPDEFCT
LVGEFLSA
NT seq 747 nt   +upstreamnt  +downstreamnt
gtggtcctgctccacggcggcgggccgggtgtcgacgccgtgagcaactgggcggcggtg
cgtcccaggctctcggccgaattccgctgcctcgcccccgacttgctcggcttcggcacg
cggatcaccggtggcgaggcgggcgccggcgggctgcacgggccgcgggcctgggcgcga
gcccgcgcgcgacaggtcctggatctgctcgatcgccacggcctggagcgtgtgcacctc
gtcggcaactcggccgcgggcggtgccgccgcgctggccctcatggccgaggctcccgaa
cggatcggccgcgcggttctcatgggtggtgcgggcaccggaccgctgccccgtgccgtt
cccttctacgaccaaccgacgagggagtccatgcgtgccacgctgggccgactggtcgcg
gacgagagcgcccaccgcgaactcctcgacgacctcacggaccttcgattggagcaagcc
ctacgccccggcgccgaagcggccttccggtccatgttcgtcgacgctgccgacgggccg
ccccccgtcgaccccgcgagggtcaccgccccggtcctcgccctgcacggggagtgcgac
cgggtcgccccggccgatgtctcggcgcgcctcgtccaggctctgccgcgtgggcgcctc
cacgtcgtgccgggggccgggcattggatccacgtcgatcgaccggatgagttctgcacc
ctggtaggggagttcctgagcgcatga

DBGET integrated database retrieval system