KEGG   Streptomyces malaysiensis: SMALA_1349Help
Entry
SMALA_1349        CDS       T05189                                 

Definition
(GenBank) crotonyl-CoA reductase
  KO
K17829  crotonyl-CoA reductase [EC:1.3.1.86]
Organism
smal  Streptomyces malaysiensis
Pathway
smal00650  Butanoate metabolism
smal01100  Metabolic pathways
smal01110  Biosynthesis of secondary metabolites
smal01120  Microbial metabolism in diverse environments
smal01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:smal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SMALA_1349
Enzymes [BR:smal01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.86  crotonyl-CoA reductase
     SMALA_1349
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_zinc_N_2 ADH_N LDcluster4
Motif
Other DBs
NCBI-ProteinID: ATL81584
UniProt: A0A291SL22
LinkDB All DBs
Position
complement(1820678..1822027)
Genome map
AA seq 449 aa AA seqDB search
MSRAVLDGASATEIEAAPVPATYLALHLRAEDTDMFKGVADKDVRKSLRLGQVPMPELAP
DEVLVAVMASSINYNTVWSAMFEPIPTFHFLKQNARQGGWAARHDQPYHVLGSDCSAVVV
RVGTGVRRWKPGDHVTVHPVHVDDQQPETHGDGMLGSEQRAWGFETNFGALAEYGIVRST
QLLPKPAHLTWEEAAVNPLCASTAYRMLVSDRGAHMKQGDIVLIWGASGGLGSYAIQFVK
NGGGIPVAVVSSAQKEAAVRALGCDLVINRTELGITDEMADDPRLVLETGRKLAKLVVEK
AGREPDIVFEHTGRVTFGLSVIVARRGGTVVTCGSSSGYLHTFDNRYLWMKLKKIVGSHG
ANYEEQQATNRLFESGAVVPAMSAVYPLAAGADACRIVQTSRQVGKVAVLCMAPEPGLGV
TDPELRGRIGEDRLNPLRGLTAGPDSREL
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
ttgtcccgagccgtgctggacggcgcgtccgccacggagatcgaggccgccccggtgccc
gccacctacctggccctgcatctgcgggctgaggacaccgacatgttcaagggggtggcc
gacaaggacgtccgcaagtcgctgcgtctcggccaggttcccatgccggagttggcgccc
gacgaggtcctcgtcgcggtgatggccagctccatcaactacaacacggtctggtcggcc
atgttcgagccgatcccgaccttccacttcctcaagcagaacgcccggcagggcggctgg
gcggcacgccacgaccagccctaccacgtgctcggctccgactgctccgccgtcgtggta
cgcgtcggcaccggcgtacggcgctggaagccgggcgaccacgtcaccgtccaccccgtg
cacgtcgacgaccagcagcccgaaactcacggtgacggcatgctcggctccgaacaacgg
gcctggggattcgagaccaacttcggcgccctggccgagtacgggatcgtccggtccacc
caactgctgcccaagcccgcccacctgacgtgggaggaggccgcggtcaaccccctgtgt
gcgtcaaccgcctaccggatgctcgtcagcgaccgcggagcccatatgaagcagggcgac
atcgtcctgatctggggcgcctccgggggcctcggctcgtacgccatccagttcgtcaag
aacggcggcggcatcccggtggctgtcgtcagctccgcgcagaaagaggcggcggtgcgc
gccctcggctgcgacttggtgatcaaccgcaccgagctgggcatcaccgacgagatggcc
gacgacccccggctcgtcctcgagaccggcaggaagctcgccaagctcgtcgtcgagaag
gccggccgggaacctgacatcgtgttcgagcacaccggccgcgtcaccttcgggctctcc
gtgatcgtggcacgacgcggcggcaccgtggtgacctgcggatccagctccggctacctg
cacaccttcgacaaccgatacctgtggatgaagctcaagaagatcgtcggcagccacggg
gccaactacgaggagcagcaggccaccaaccggctgttcgagagcggcgccgtcgtcccg
gccatgtcggccgtctatccgctcgccgcgggcgccgacgcgtgccggatcgtccagacc
agccggcaggtgggcaaggtcgcggtgctctgcatggcaccggaacccgggctcggggtg
accgaccccgaactgcgcggccggatcggggaggaccggctcaacccgctgcgcggtctc
accgccggccccgattccagggagctctga

DBGET integrated database retrieval system