KEGG   Streptomyces malaysiensis: SMALA_1383Help
Entry
SMALA_1383        CDS       T05189                                 

Definition
(GenBank) acetolactate synthase large subunit
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
smal  Streptomyces malaysiensis
Pathway
smal00290  Valine, leucine and isoleucine biosynthesis
smal00650  Butanoate metabolism
smal00660  C5-Branched dibasic acid metabolism
smal00770  Pantothenate and CoA biosynthesis
smal01100  Metabolic pathways
smal01110  Biosynthesis of secondary metabolites
smal01210  2-Oxocarboxylic acid metabolism
smal01230  Biosynthesis of amino acids
Module
smal_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
smal_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:smal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SMALA_1383
   00660 C5-Branched dibasic acid metabolism
    SMALA_1383
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    SMALA_1383
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SMALA_1383
Enzymes [BR:smal01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     SMALA_1383
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C ANF_receptor XFP_N Cpn60_TCP1
Motif
Other DBs
NCBI-ProteinID: ATL81618
UniProt: A0A291SLA5
LinkDB All DBs
Position
complement(1895729..1897516)
Genome map
AA seq 595 aa AA seqDB search
MPVLTGGQIVARTLRNYGVDYVAGIPGHGIWSLTDAFLDDESKIPFIQTFHEQSAVHLAD
GYYRVTGRPQAAVTSIGAGASNTVIGMGTAFTDSTSVLVITGGPPTHMRGHGLLQELDRY
TANDFPKVAEAVSKRHWVATRVEELPFVLHRCFNSMLTGRPGPVHLEVPMDVQAEAADVD
LHDLARRMPVGRQHPDPEAVDRAVDVLRGATRPVIVVGGGAITSDASDQVLALAEHWQIP
VVTTWNGKSAFPEDHTLFAGSVGQTGTIVGNAIASSADVVISVGCRFTDWSASSYAKGVS
FSIPPAKLIHIDIDPHEIGKNYPAEVGIVADAQRTVAAIVDALPQQGSDRSEYLAELATL
KRQWEEKLAGRRDSDRFPFTSQRPLGALRSVLPRDAIIVAGSGNTQGAVKQTFPVYSPRT
HLTSGGFSSMGWAVPAAVGAKLGRPDRPVVCVLGDGDFLMTAQEIALSVTTGAPVVFVVQ
NNAGYMSIRGGQRKQTSRHIGTEFSYPDGTPYSPDFAAMGRSYGIESWKVSDADSLEGTL
RKAVQSGEPALVEIPTDRDAAGPWVPGWWDFPVPAYITDERQEEYQRTRSTEQHL
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtcctcaccggaggccagatcgtcgcgcggaccctgcgcaactacggcgtcgac
tacgtggccggcattcccggccacggcatctggtcactgaccgacgccttcctggacgac
gaatccaagatcccgttcatccagaccttccatgagcagagcgccgtccacctcgccgac
ggctactaccgcgtcaccggccgcccccaggccgccgtgacgtccatcggcgcgggcgcc
agcaacaccgtcatcggcatgggcaccgctttcaccgactccaccagcgtcctcgtcatc
accggcggcccgcccacccatatgcgcggccacggcctgctccaggagctcgaccgctac
acggccaacgacttccccaaggtcgccgaggccgtcagcaagcgccactgggtcgccacc
cgcgtcgaggaactccccttcgtcctgcaccgctgtttcaactccatgctgaccggccgc
cccgggcccgtgcacctcgaagtgcccatggacgtacaggccgaggccgcggacgtcgac
ctccacgacctggcccggcgcatgcccgtcggccgccagcaccccgaccccgaggcggtg
gaccgcgccgtcgacgtgctccgcggggccacccggccggtcatcgtcgtcggcggtggc
gccatcacctccgacgcctccgaccaggtcctggccctggccgagcactggcagatccca
gtcgtgaccacctggaacggcaagagtgccttccccgaggaccacacgctgttcgccggc
agcgtcggacagaccggcacgatcgtcggcaacgcgatcgccagctccgccgatgtcgtc
atctccgtcggctgccgcttcaccgactggtcggcctccagctacgccaagggcgtcagc
ttctccattccgccggcaaagctcatccacatcgacatcgacccccatgagatcggcaag
aactaccccgccgaggtgggcatcgtcgccgacgcacagcggaccgtggccgcgatcgtc
gacgccctgccccagcagggcagcgaccgctccgaatacctcgccgagctggccaccctc
aagcggcagtgggaggagaagctcgccggccgccgcgacagcgaccgcttccccttcacc
tcgcagcgcccgctcggcgccctgcgctccgttcttccccgcgacgcgatcatcgtcgcc
ggctcgggcaacacccagggcgcggtcaagcagaccttcccggtgtactccccgcgcacc
cacctcacctcgggcggcttctcctccatgggctgggccgtcccggcggcggtcggcgcc
aagctgggccggcccgaccgtcccgtggtgtgcgtcctgggcgatggtgacttcctcatg
accgcgcaggagattgccctgagcgtcaccaccggcgcaccggtggtcttcgtcgtccag
aacaacgcgggctacatgtcgatccgcggcggccagcgcaagcagacctcccggcacatc
ggtaccgagttctcctatcccgacggcacgccgtacagccccgactttgccgccatgggc
cggtcctacggcatcgaatcgtggaaggtgtcggatgccgactccctggaggggacgctg
cgcaaggccgtccagtcgggcgagcccgcgctggtggagatcccgacagaccgcgacgcc
gccggtccctgggtgccgggctggtgggacttcccggttccggcgtacatcacggacgaa
cggcaggaggagtaccagcgcactcggtccaccgagcagcacctctga

KEGG   Streptomyces malaysiensis: SMALA_5481Help
Entry
SMALA_5481        CDS       T05189                                 

Definition
(GenBank) acetolactate synthase 1 catalytic subunit
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
smal  Streptomyces malaysiensis
Pathway
smal00290  Valine, leucine and isoleucine biosynthesis
smal00650  Butanoate metabolism
smal00660  C5-Branched dibasic acid metabolism
smal00770  Pantothenate and CoA biosynthesis
smal01100  Metabolic pathways
smal01110  Biosynthesis of secondary metabolites
smal01210  2-Oxocarboxylic acid metabolism
smal01230  Biosynthesis of amino acids
Module
smal_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
smal_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:smal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SMALA_5481
   00660 C5-Branched dibasic acid metabolism
    SMALA_5481
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    SMALA_5481
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SMALA_5481
Enzymes [BR:smal01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     SMALA_5481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C POR_N CO_dh
Motif
Other DBs
NCBI-ProteinID: ATL85711
UniProt: A0A291SY19
LinkDB All DBs
Position
6735922..6737772
Genome map
AA seq 616 aa AA seqDB search
MTEQAPGSHHPQPRPRSGGPQSAPVEHVTGAQSLIRSLEEVGADTVFGIPGGTILPAYDP
MMDSSKVRHVLVRHEQGAGHAATGYAQATGRVGVCMATSGPGATNLVTPIGDAHMDSVPI
VAITGQVASKAIGTDAFQEADICGITMPITKHNFLVTKAEDIPRTIAEAFHIASTGRPGP
VLVDIPKDVLQARTTFSWPPQIDLPGYRPVTKPHAKQIREAARLITQAERPVLYVGGGVI
KAQATAELKVLAELTGAPVTTTLMALGAFPDSHHLHLGMPGMHGTVAAVTALQKADLIVA
LGARFDDRVTGKLDSFAPFAKIVHADIDPAEIGKNRAADVPIVGDAREVLADLVVAVQAE
HDAGRAGDYTGWWEDLNRWRETYPLGYDQPTDGSLSPQQVIQRIGQLAPEDTIFAAGVGQ
HQMWAAHFIDYETPATWLNSGGAGTMGYAVPAAMGAKAGAGGRTVWAIDGDGCFQMTNQE
LATCALNNIPIKVAIINNGALGMVRQWQTLFYNQRYSNTVLHSGPDTPVQRNLGTRVPDF
VKLSEAMGCVGLRCEDPADLDAVIEKANAINDRPVVVDFIVHEDAMVWPMVAAGTSNDEI
LAARDTRPDFGDGEDD
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagcaggcccccgggtcccatcacccccagcctcggccccgtagcggcggaccg
cagtccgcccccgtcgagcacgtcacgggcgcgcagtccctcatccgctcgctcgaggag
gtgggtgccgacaccgtcttcggcatccccggcggcacgatcctccccgcctacgacccg
atgatggactcctcgaaggtccggcatgtgctagtccgccatgagcagggcgcgggccac
gccgccaccggctacgcccaggccaccggcagggtcggcgtctgcatggcgacctcgggc
cccggggccaccaacctggtcacccccatcggcgacgcccatatggactcggtcccgatc
gtcgcgatcaccggccaggtggcctccaaggccatcggcacggacgccttccaggaggcg
gacatctgcggcatcaccatgccgatcaccaagcacaacttcctggtcaccaaggccgag
gacatcccccgcacgatcgccgaggcgttccacatcgcctccaccggccgccccggcccg
gtgctggtcgacatccccaaggacgtgctccaggcgcggaccaccttctcctggccgccg
cagatcgatctgcccggctaccgcccggtcaccaagccgcacgccaagcagatccgcgag
gccgcccgcctgatcacccaggccgagcgcccggtgctgtacgtcggcggcggcgtgatc
aaggcccaggccaccgccgagctgaaggtgctggccgagctgaccggcgcgccggtcacc
accaccctgatggcgctgggcgccttccccgacagccaccacctccacctcggcatgccg
ggcatgcacggcaccgtcgccgccgtgacggccctccagaaggccgatctgatcgtggcg
ctcggcgcccgtttcgacgaccgcgtcaccggcaagctggactccttcgcccccttcgcc
aagatcgtccacgcggatatcgacccggccgagatcggcaagaaccgcgccgccgacgtg
cccatcgtcggggacgcccgtgaggtcctcgcggacctggtcgtcgccgtccaggccgag
catgacgcgggccgcgcgggtgactacaccggctggtgggaggacctgaaccggtggcgg
gagacctacccgctcggctacgaccagcccaccgacggcagcctctccccgcagcaggtg
atccagcggatcgggcagctggccccggaggacacgatcttcgccgcgggcgtcggccag
caccagatgtgggcggcccacttcatcgactacgagacccccgccacctggctgaactcg
ggtggcgccggcaccatgggctacgccgtgccggccgccatgggcgccaaggccggtgcc
gggggccgtacggtctgggcgatcgacggcgacggctgcttccagatgaccaaccaggag
ctggccacctgcgcgctgaacaacatcccgatcaaggtcgcgatcatcaacaacggcgcg
ctgggcatggtccgccagtggcagaccctcttctacaaccagcgctactccaacacggtc
ctgcactccggcccggacacccccgtccagcggaacctgggcacccgcgtccccgatttc
gtgaagctctcggaggccatgggctgtgtcgggctgcgctgcgaggacccggccgacctc
gacgccgtgatcgagaaggccaacgcgatcaacgaccgcccggtggtcgtggacttcatc
gtccatgaggacgccatggtctggccgatggtcgcggccggcacctccaacgacgagatc
ctggcggcgcgcgacacccgcccggacttcggcgacggcgaagacgactga

KEGG   Streptomyces malaysiensis: SMALA_5482Help
Entry
SMALA_5482        CDS       T05189                                 

Definition
(GenBank) acetolactate synthase 3 regulatory subunit
  KO
K01653  acetolactate synthase I/III small subunit [EC:2.2.1.6]
Organism
smal  Streptomyces malaysiensis
Pathway
smal00290  Valine, leucine and isoleucine biosynthesis
smal00650  Butanoate metabolism
smal00660  C5-Branched dibasic acid metabolism
smal00770  Pantothenate and CoA biosynthesis
smal01100  Metabolic pathways
smal01110  Biosynthesis of secondary metabolites
smal01210  2-Oxocarboxylic acid metabolism
smal01230  Biosynthesis of amino acids
Module
smal_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
smal_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:smal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SMALA_5482
   00660 C5-Branched dibasic acid metabolism
    SMALA_5482
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    SMALA_5482
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SMALA_5482
Enzymes [BR:smal01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     SMALA_5482
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALS_ss_C ACT ACT_5 ACT_4 DUF5517
Motif
Other DBs
NCBI-ProteinID: ATL85712
UniProt: A0A291SXW4
LinkDB All DBs
Position
6737806..6738330
Genome map
AA seq 174 aa AA seqDB search
MSKHTLSVLVENTPGILARIAALFSRRGFNIDSLAVGVTEHPDISRITIVVNVEELPLEQ
VTKQLNKLVNVLKIVELEDGHAIQRELVLVKVRADNETRSQIVEIVQLFRAKTVDVSPEA
VTIEATGSSDKLEAMLRMLEPYGIKELVQSGTIAIGRGARSITDRSLRSLDRSA
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagcacacgctctccgtcctggtggagaacacccccggtatcctggcccggatc
gccgccctgttctcccgccgcggcttcaacatcgactcgctggccgtcggcgtcaccgag
caccccgacatctcccggatcaccatcgtggtcaatgtcgaggagctgccgctcgagcag
gtcaccaagcagctcaacaagctggtcaatgtgttgaagatcgtcgagctggaggacggc
cacgcgatccagcgggagctcgtgctggtgaaggtccgcgccgacaacgagacccgctcc
cagatcgtcgagatcgtccagctgttccgcgccaagaccgtggacgtctccccggaggcc
gtgaccatcgaggccaccggcagcagtgacaagctggaggccatgctcaggatgctggaa
ccgtacggcatcaaggagctggtccagtccggcaccatcgccatagggcgtggcgcccgc
tccatcaccgaccggagcctgcgctcgctcgaccggtccgcctga

KEGG   Streptomyces malaysiensis: SMALA_5589Help
Entry
SMALA_5589        CDS       T05189                                 

Definition
(GenBank) acetolactate synthase large subunit
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
smal  Streptomyces malaysiensis
Pathway
smal00290  Valine, leucine and isoleucine biosynthesis
smal00650  Butanoate metabolism
smal00660  C5-Branched dibasic acid metabolism
smal00770  Pantothenate and CoA biosynthesis
smal01100  Metabolic pathways
smal01110  Biosynthesis of secondary metabolites
smal01210  2-Oxocarboxylic acid metabolism
smal01230  Biosynthesis of amino acids
Module
smal_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
smal_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:smal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SMALA_5589
   00660 C5-Branched dibasic acid metabolism
    SMALA_5589
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    SMALA_5589
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SMALA_5589
Enzymes [BR:smal01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     SMALA_5589
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: ATL85819
UniProt: A0A291SY73
LinkDB All DBs
Position
complement(6855435..6857111)
Genome map
AA seq 558 aa AA seqDB search
MPSAQRARHGGDLVVESLTALGASTVFGLPGQHALGAFDALRRSGLAYVGLRVENNAGFA
ADAFARVTGTVAPLLVSTGPGALMTLAALQESAAASAPVLAIGSQVPTAGLGGGRKGYLH
ELVDQKASFRDVVKSVHTVRTASQIPSAVAAAWASALEAPAGPVWLEIPQDVLLAPVLVP
PVASLRAEPRPLPPRPELTAEAARLLSAAERPVILAGGGVVRAGARQELRALAEALDAPV
ATTFGGKGAFPWDHPLSLQSWLEDAHTTEFLEDADVLLVIGSGLGELSSNYHTFRPRGRL
IQIEADLGKLESNHPALGIHADAREALAALAESITPRSPGTGAKATAGLLTRVRERIDAQ
GLELERRVLDAVRNALPDDSPSFWDMTILAYWAWSAFDPRAGALHSAQGAGGLGYGFPAA
LGAAAADRRRPVLAVSGDGGAMYSIAELATAHQYQLPVTWLIVDDGGYGILREYMTDTFG
EATATELSRPDFAALAESFGVPAVRTTPERLRADLAGALAAPGPSVVVLPALLRMFAPTH
LDRLPGGGPDSGPGPDQP
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgcccagcgcacagcgcgcgcgtcacggcggcgatctcgtcgtggagtccctcaccgcg
ctcggggcgagcaccgtgttcggacttcccggacagcacgctctcggcgcgttcgacgcg
ctgcggcggtccggactggcctatgtgggactgcgggtggagaacaacgccgggttcgcc
gccgacgccttcgcgcgcgtcaccggcacggtggcgccgctgttggtgtccaccgggccg
ggggcgctcatgacgctcgccgcgctgcaagagtcggcggcggcctccgcgcccgtcctg
gccatcggcagccaggtgccgaccgcggggctcggcggcgggcgcaagggctatctccat
gaactcgtcgaccagaaggcgtcgttccgcgacgtcgtcaagtccgtccacaccgtccgt
accgcctcccagatcccctccgcggtcgccgccgcctgggcgtccgcgctggaggccccc
gccgggccggtgtggctggagatcccgcaggacgtgctgctcgcaccggtcttggtgcca
ccggtggcctccctgcgcgccgagccccggccgctgccgccccggcccgagctgacggcg
gaggccgcgcggctgctgagcgccgccgagcgcccggtgatcctggccggcggcggagtc
gtgcgcgccggggcgcggcaggagctcagggcgctggccgaggcactcgacgcgcccgtg
gcgacgaccttcggcggcaagggcgccttcccctgggatcatccgctctccctccagtcc
tggctggaggacgcgcacaccaccgagttcctggaggacgccgatgtcctgctggtcatc
ggctccggactcggtgaactctcctccaactaccacacgttccgcccccgcggccgcctg
atccagatcgaggccgacctcggcaagctggagtccaaccacccggcgctcggtatccac
gccgacgcccgcgaggcgctggccgccctcgccgagtccatcacgccccgttcgccgggc
accggggccaaggccacggccgggctgctgacccgggtgcgggagcggatcgacgcccag
ggcctggagctggagcggcgggtgctggacgcggtgcggaacgcgctgcccgacgactcc
cccagcttctgggacatgacgatcctcgcctactgggcctggtccgccttcgatccgcgt
gcgggcgccctgcactcggcgcagggcgcgggcggcctcggctacggcttcccagccgcc
ctgggggccgccgccgcggaccgtcgcaggccggtgctggccgtgtccggcgacggcggc
gcgatgtactcgatcgccgaactggccactgcccatcagtaccaactccctgtcacctgg
ctgatcgtggacgacggcggctacggcatcctgcgcgagtacatgacggacaccttcggc
gaggcgaccgccaccgagctgtcccgcccggacttcgccgcgctggccgagtccttcggc
gtcccggcggtccgtaccacacccgaacggctgcgagcggacctcgcgggcgccctcgcg
gcccccgggccatcggtcgtggtgctgcccgcgctgctgcggatgttcgcgcccacccac
ctcgaccgactccccggcggcggccccgacagcggtcccgggcccgatcagccctga

KEGG   Streptomyces malaysiensis: SMALA_6213Help
Entry
SMALA_6213        CDS       T05189                                 

Definition
(GenBank) TPP-requiring enzyme
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
smal  Streptomyces malaysiensis
Pathway
smal00290  Valine, leucine and isoleucine biosynthesis
smal00650  Butanoate metabolism
smal00660  C5-Branched dibasic acid metabolism
smal00770  Pantothenate and CoA biosynthesis
smal01100  Metabolic pathways
smal01110  Biosynthesis of secondary metabolites
smal01210  2-Oxocarboxylic acid metabolism
smal01230  Biosynthesis of amino acids
Module
smal_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
smal_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:smal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SMALA_6213
   00660 C5-Branched dibasic acid metabolism
    SMALA_6213
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    SMALA_6213
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SMALA_6213
Enzymes [BR:smal01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     SMALA_6213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M Bmp
Motif
Other DBs
NCBI-ProteinID: ATL86441
UniProt: A0A291T065
LinkDB All DBs
Position
complement(7647902..7649626)
Genome map
AA seq 574 aa AA seqDB search
MQGRTDPYEGTRFAMPDDSQDLISGGHLVAKALKAEGVEVIYTLCGGHIIDIYDGCVDEG
IDVIDVRHEQVAAHAADGYARITGKPGCAVVTAGPGTTDAVTGVANAFRAESPMLLIGGQ
GAHTQHKMGSLQDLPHVDMMAPITKFAATVPDTARAADMVSMAFRECFHGAPGPSFLEIP
RDVLDAKVPVDKARVPLAGHYRASTRAAGDPESVQKLADLLVQAEKPAILLGSQVWTTRA
TGSAIELVRTLNVPAYMNGAGRGTLPPGDPHHFQLSRRYAFSNADLIIIVGTPFDFRMGY
GKRLSPDATVVQIDLDYRTVGKNRDIDLGIVGDAGLILSAVTQAASGRINGGAGKRKEWL
DELRAAEQKAIEKRLPNLRSDASPIHPYRLVSEINDFLTEDSIYIGDGGDIVTFSGQVIQ
PKSPGHWMDPGPLGTLGVGVPFVMAAKKARPDKEVVALFGDGAFSLTGWDFETLVRFDLP
FVGIVGNNSSMNQIRYGQKAKYGEQRERVGNTLGDVPYDQFARMLGGHGEEVRDPADIGP
ALRRARESGKPSLINVWVDPDAYAPGTMNQTMYK
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaggccgtaccgacccctacgaagggacgcgattcgccatgcccgacgacagccag
gacctcatttccggcgggcacttggtcgccaaagcactcaaagcagaaggcgtcgaggtc
atctacaccctctgcggcggccacatcatcgatatctacgacggctgtgtcgacgagggc
atcgacgtcatcgatgtacgccacgaacaggtcgccgcccacgccgccgacggctacgcc
cggatcaccggcaagcccggctgcgcggtcgtcaccgccggccccggcaccaccgacgcg
gtcaccggcgtcgccaacgccttccgcgccgagtcacccatgctgctcatcggcggccag
ggagcccacacccagcacaagatggggtccctccaggacctcccccatgtggacatgatg
gcgccgatcaccaagttcgccgccaccgtcccggacaccgcccgcgccgccgacatggtc
tccatggccttccgcgagtgcttccacggcgcccccggcccctccttcctggagatcccg
cgggatgtgctggacgccaaggtgccggtggacaaggcgcgcgtccccctggcggggcac
taccgcgcctccacgcgcgccgccggggaccccgagtccgtccagaagctggccgatctg
ctggtccaggccgagaagccggcgatcctgctgggcagccaggtgtggaccacccgcgcc
accggctcggccatcgagctggtgcgcaccctcaatgtgcccgcgtacatgaacggcgcg
gggcgcggcacccttccgcccggcgatccgcaccacttccagctctcccgccgctacgcc
ttctccaacgccgacctcatcatcatcgtcggcacgcccttcgacttccggatgggctac
ggcaagcggctctcccccgacgccaccgtggtccagatcgacctcgactaccgcacggtc
ggcaagaaccgggacatcgacctgggcatcgtgggcgacgcggggctgatcctctccgcc
gtcacccaggctgcctccggccgcatcaacggcggcgcgggcaagcgcaaggagtggctg
gacgagctgcgggccgccgagcagaaggcgatcgagaagcggctgcccaacctccgctcc
gacgcctcccccatccatccgtaccgcctggtcagcgagatcaacgacttcctcaccgag
gactcgatctacatcggcgacggcggcgacatcgtcaccttctccggtcaggtgatccag
cccaagtcgcccggccactggatggacccgggcccgctggggacgctcggcgtcggggtg
ccgttcgtgatggccgccaagaaggcccgccccgacaaggaggtggtggcgctcttcggc
gacggcgccttctccctgaccggctgggacttcgagacgctggtccgcttcgacctgccg
ttcgtcggcatcgtcggcaacaactcctcgatgaaccagatccgttacggccagaaggcc
aagtacggcgagcagcgcgagcgggtcggaaacaccctgggcgatgtgccctacgaccag
ttcgcccggatgctcggcggccacggcgaggaggtccgcgacccggcggacatcggcccg
gcgctgcgccgcgcccgcgagtccggcaagccgtcgctgatcaacgtctgggtggacccg
gacgcgtacgcccccggaaccatgaaccagaccatgtacaagtag

KEGG   Streptomyces malaysiensis: SMALA_7986Help
Entry
SMALA_7986        CDS       T05189                                 

Definition
(GenBank) acetolactate synthase, large subunit
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
smal  Streptomyces malaysiensis
Pathway
smal00290  Valine, leucine and isoleucine biosynthesis
smal00650  Butanoate metabolism
smal00660  C5-Branched dibasic acid metabolism
smal00770  Pantothenate and CoA biosynthesis
smal01100  Metabolic pathways
smal01110  Biosynthesis of secondary metabolites
smal01210  2-Oxocarboxylic acid metabolism
smal01230  Biosynthesis of amino acids
Module
smal_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
smal_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:smal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SMALA_7986
   00660 C5-Branched dibasic acid metabolism
    SMALA_7986
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    SMALA_7986
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SMALA_7986
Enzymes [BR:smal01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     SMALA_7986
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M Glyco_transf_4
Motif
Other DBs
NCBI-ProteinID: ATL88196
UniProt: A0A291T4Y3
LinkDB All DBs
Position
10018139..10019830
Genome map
AA seq 563 aa AA seqDB search
MSTSKTGGQLVVDMLASLGVEYVFGVVGGQTLAISDAIIDTPGIELIHTRHENAAAVMMD
AYGRLTGKPAACISTTGPGATNLLTGVGGAYRDSSPGFVITCNNNGENIHKDDAQNADHV
ELFKPLVKYSRLVAHASSIKQAIEEAYVNALTGNPGPVHLDFARDTIEGQVANPPAVPSV
HPSRGWVTERPSVNPVALARVAERVLEAERPVIWLGNGGNRAQASDDVLALADELGIPVV
TTFNGIGSVPTTHPLVFGAASRMGTALSDQVLGEADLVLALGNSLNAVSTTRWRRELPEI
VQVDVDPAMIGRYYSEITQGVVGDLGSFARDLVVATAGRAEDAKAGRAHWIATLDKARAD
WWQGSVVADTTAGGPLSPADIVRTLREVAPENTLLIPDAGNPGVWSFLWEIQQPNSYIKP
VGFGNMGFALPSAIAASLIDPERPVLALIGDGSLGMSLGEIETLARVGGNVCVIVFNDSS
YGNIRQEQELHFNGRTTGVDFGRVDFGMAARAMGVHGEVVTRLAVLRERVAEAFAAGTPV
VLDVPIDRDVNAWTFPSFAARKK
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgagtacttccaagaccggtggccagctcgtcgtcgacatgctggcttcgctcggcgtc
gagtacgtcttcggagtcgtgggcgggcagaccctcgccatctccgacgccatcatcgac
acccccggcatcgagctgatccacacccggcacgagaacgccgcggccgtgatgatggac
gcctacggtcggctcacgggcaagcccgcggcctgtatctccacgaccggccccggcgcg
accaacctcctcaccggtgtcggcggcgcctaccgcgactccagccccgggttcgtcatc
acctgcaacaacaacggtgagaacatccacaaggacgatgcccagaacgccgaccacgtg
gagctgttcaaaccgctggtgaagtactctcggctggtcgcgcacgcctcttccatcaag
caggcgatcgaggaggcatacgtcaacgccctcaccggcaatcccggcccggtgcacctc
gacttcgcccgcgacaccatcgagggccaggtcgcgaacccgcccgcggtgccctccgta
caccccagccgtggctgggtcaccgagcgcccctccgtcaacccggtcgcgctggcccgg
gtggccgaacgtgtcctggaggccgaacggccggtcatctggctcggcaacggcggcaac
cgggcgcaggcgagcgacgacgtcctggcactcgcggacgagctcggcatcccggtcgtc
acgacgttcaacggcatcggttccgtcccgaccacccatccgctggtgttcggcgcggcc
agccgcatgggtaccgccctctccgaccaggttctcggtgaggccgacctcgtgctggcg
ctgggcaacagcctcaacgcggtgtccaccacccgctggcgccgggaactccccgagatc
gtgcaggtcgacgtcgatccggcgatgatcggacgctactactccgagatcacccagggc
gtcgtcggcgacctcggctccttcgcccgggacctggtcgtcgcgaccgccggacgagcg
gaggacgcgaaggccggacgcgcacactggatcgcgaccctcgacaaggcacgcgccgac
tggtggcagggctccgtcgtggccgacaccaccgctggcgggccgctgtccccggccgac
atcgtccgcaccctgcgcgaggtggctcccgagaacaccctgctcattccggatgccggc
aacccgggagtgtggtcgttcctctgggagatccagcagcccaacagctacatcaagccc
gtcgggttcgggaacatggggttcgcccttccgtccgcgatcgcggcctcgctgatcgac
cccgagcgtccggtgctcgcgctgatcggcgacggttcgctcggcatgagcctcggcgag
atcgagacgctcgcccgcgtcggcggcaatgtctgcgtcatcgtcttcaacgactccagc
tacggcaatatccgccaggagcaggaactgcacttcaacggccgcacgaccggtgtcgac
ttcggccgggtcgacttcggcatggcggcccgcgcgatgggtgtgcacggcgaggtcgtc
acccggctcgccgtactccgtgagcgcgtggccgaggcgttcgcggcgggcacgccggtg
gtgctcgacgtgccgatcgaccgtgatgtcaacgcctggacgttcccctcgttcgcggcg
cggaagaagtag

DBGET integrated database retrieval system