KEGG   Streptomyces malaysiensis: SMALA_1824Help
Entry
SMALA_1824        CDS       T05189                                 

Definition
(GenBank) diaminobutyrate--2-oxoglutarate aminotransferase
  KO
K00836  diaminobutyrate-2-oxoglutarate transaminase [EC:2.6.1.76]
Organism
smal  Streptomyces malaysiensis
Pathway
smal00260  Glycine, serine and threonine metabolism
smal01100  Metabolic pathways
smal01120  Microbial metabolism in diverse environments
smal01210  2-Oxocarboxylic acid metabolism
smal01230  Biosynthesis of amino acids
Module
smal_M00033  Ectoine biosynthesis, aspartate => ectoine
Brite
KEGG Orthology (KO) [BR:smal00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SMALA_1824
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:smal01007]
    SMALA_1824
Enzymes [BR:smal01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.76  diaminobutyrate---2-oxoglutarate transaminase
     SMALA_1824
Amino acid related enzymes [BR:smal01007]
 Aminotransferase (transaminase)
  Class III
   SMALA_1824
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ATL82058
UniProt: A0A291SMJ3
LinkDB All DBs
Position
2426382..2427644
Genome map
AA seq 420 aa AA seqDB search
MTITPPALSVFEALESEVRSYCRGWPAVFDRAQGSHMYDEDGHTYLDFFAGAGSLNYGHN
NPVLKRALIDYIERDGVTHGLDMSTTAKRAFLESFQNHILRPRDLPYKVMFPGPTGTNAV
EAALKLARKVKGREAIVSFTNAFHGMSLGSLAVTGNAFKRAGAGIPLVHGTPMPFDNYFD
GTIPDFLWFERLLEDQGSGLNQPAAVIVETVQGEGGINVARPEWLRALAELCERQDMLLI
VDDIQMGCGRTGAFFSFEEAGITPDIVTVSKSISGYGMPMSLALFKPELDIWEPGEHNGT
FRGNNPAFVTAAATLDTYWADGQMEKQTLARGEQVELALRAICEEQSGTQFRGRGLVWGL
EFDDKPRATAVCRRAFELGLLLETSGPESEVVKLLPALTISPDDLDEGLRTLARAVRETA
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
gtgaccatcaccccgcccgccctgagcgtcttcgaggccctggagtcggaggtgcgcagc
tactgccgtggctggcccgccgtcttcgaccgcgcgcagggcagccacatgtacgacgag
gacggccacacgtacctcgacttcttcgccggagccgggtcgctcaactacggccacaac
aacccggtgctgaaacgggcgctgatcgactacatcgagcgtgacggcgtcacgcacggc
ctggacatgtccaccacggccaagcgcgcgttcctcgaatcgttccagaaccacatcctg
cgcccgcgcgatctgccctacaaggtcatgttcccgggcccgaccggcaccaacgccgtc
gaggccgccctgaagctggcccgtaaggtcaagggccgcgaggccatcgtctccttcacc
aacgccttccacggcatgtcgctgggctcactggccgtgaccggcaacgccttcaagcgc
gccggtgcgggcatcccgctggtccacggcaccccgatgccgttcgacaactacttcgac
ggcacgatcccggacttcctgtggttcgagcggctgctggaggaccagggctccggcctc
aaccagcccgccgccgtgatcgtcgagaccgtacagggcgagggcggcatcaacgtggcg
cggcccgagtggctgcgcgccctggccgagctgtgcgagcgccaggacatgctgctgatc
gtcgacgacatccagatgggctgcggccgcacgggcgccttcttctccttcgaggaggcg
ggcatcaccccggacatcgtgaccgtctccaagtccatcagcggctacggcatgccgatg
tcgctcgccctcttcaagcccgagctggacatctgggagcccggtgagcacaacggcacc
ttccgcggcaacaaccccgcgttcgtgaccgccgccgcgaccctggacacctactgggcc
gacggccagatggagaagcagaccctggcccgcggcgagcaggtcgagctggccctgcgc
gccatctgcgaggagcagtccggcacccagttccgcggccgcggcctggtgtgggggctg
gagttcgacgacaagccgcgcgccacggcggtctgccggcgcgccttcgagctggggctg
ctgctggagacgtccggccccgagagcgaggtcgtcaagctgctgcccgcgctgacgatc
tcccccgatgacctggacgaggggctgcggaccctcgcccgcgcggtccgcgagaccgca
tga

DBGET integrated database retrieval system