KEGG   Streptomyces malaysiensis: SMALA_2232Help
Entry
SMALA_2232        CDS       T05189                                 

Definition
(GenBank) tartrate dehydrogenase
  KO
K07246  tartrate dehydrogenase/decarboxylase / D-malate dehydrogenase [EC:1.1.1.93 4.1.1.73 1.1.1.83]
Organism
smal  Streptomyces malaysiensis
Pathway
smal00630  Glyoxylate and dicarboxylate metabolism
smal00650  Butanoate metabolism
smal01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SMALA_2232
   00650 Butanoate metabolism
    SMALA_2232
Enzymes [BR:smal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.83  D-malate dehydrogenase (decarboxylating)
     SMALA_2232
    1.1.1.93  tartrate dehydrogenase
     SMALA_2232
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.73  tartrate decarboxylase
     SMALA_2232
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ATL82466
UniProt: A0A291SNJ9
LinkDB All DBs
Position
2897204..2898274
Genome map
AA seq 356 aa AA seqDB search
MTNRRTTNHRIALIPGDGIGNEVIPAARRVLDAVAARHGLGFTYETFDWSCERYLSQGAM
MPEDGLDRLRGHDAILLGAVGYPGVPDHVSLWGLLIPIRRGFQQYVNLRPIRVFEGVPSP
LRGAGPGDVDLVVVRENVEGEYGEIGGRLARGLPEEMAVQEAVFTRKGVTRVLDYAFSLA
ERRGGRLTSATKSNGIIHTMPFWDELVAERAAAHPEVAWDQEHIDALAAKFVLDPQRFDV
VVASNLFGDILSDLAAAVAGSIGIAPAANLNPERDFPSMFEPVHGSAPDIAGRGIANPLG
AIWSAAMLLDHLGHPEAATRVTDAIATVLAKTPVRTPDLGGTATTEDFTDALLELL
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaccgccgcacgaccaaccaccgcatcgccctgatccccggcgacggcatcggc
aacgaggtcatcccggccgcccgccgcgtcctggacgccgtcgccgcccggcacggcctc
ggcttcacctacgagacgttcgactggtcctgcgagcgctacctcagccagggcgcgatg
atgcccgaggacggtctggaccggctgcgcggccatgacgcgatcctgctcggcgccgtc
ggctaccccggcgtccccgaccatgtctcgctgtggggtctgctgatccccatccgccgg
ggcttccagcagtacgtcaatctgcgccccatccgcgtcttcgagggcgtgcccagcccg
ctgcgcggggccgggcccggcgatgtggacctcgtcgtggtccgggagaacgtcgagggc
gagtacggcgagatcggcggccgcctcgcacgggggctgccggaggagatggccgtccag
gaggcggtgttcacccgtaagggcgtcacccgcgtcctggactacgccttctccctggcc
gagcggcgcggtgggcgcctcacctcggcgaccaagtccaacggcatcatccacaccatg
cccttctgggacgaactcgtcgccgaacgcgccgccgcgcacccggaggtggcctgggac
caggagcacatcgacgccctcgccgcgaagttcgtcctcgaccctcagcgcttcgacgtc
gtcgtggcctccaacctcttcggcgacatcctcagcgacctggccgccgcggtcgcgggc
agcatcggcatcgcacccgcggccaacctcaaccccgaacgcgacttcccgtccatgttc
gagccggtccatggctccgcgcccgatatcgcggggcgcggcatcgccaacccgctcggc
gcgatctggtccgccgccatgctgctcgaccacctcggccaccccgaggcggccacccgc
gtcaccgacgccatcgcgaccgtcctggcgaagacccccgtccgcacccccgacctgggc
ggcacggccaccacggaggacttcaccgacgccctgctcgaactgctctga

DBGET integrated database retrieval system