KEGG   Streptomyces malaysiensis: SMALA_3077Help
Entry
SMALA_3077        CDS       T05189                                 

Definition
(GenBank) serine/threonine protein kinase
Organism
smal  Streptomyces malaysiensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: ATL83311
UniProt: A0A291SR45
LinkDB All DBs
Position
complement(3971169..3972863)
Genome map
AA seq 564 aa AA seqDB search
MRPVGSKYLLEEPLGRGATGTVWRARQTTPAGAEAAVAGQPGETVAIKVLKEELANDADI
VMRFLRERSVLLRLTHPNIVRTRDLVVEGDLLALVMDLIDGPDLHNYLRSNGPFTPVAAS
LLTAQIADALAASHADGVVHRDLKPANVLLAGTGEGQEMHPMLTDFGIARLADSPGLTRT
QEFVGTPAYVAPESAEGRPQTSAVDIYGAGIMLYELVTGRPPFAGNTALEVLHRHLSEEP
RRPSTVPEPLWTVIERCLRKRPEERPSAENLARGLRVVAAGVGVHASAAQAEEALGVAAL
LAPDPAPAPVPDTAPAGSAEPTQVLPTNAPAGSPSYDPAAATNVMPTAGANADPTQVLPS
GSGPAGGPDPTRAMPPVPPGGPGQDDPHPWQNQLRAARDRNEQTQVQYLDPSQDPLRRRP
QRPAPQQYQQPQQYQQPQQQPPQRQRGRQQPPPYAQQQPQQYAPAPHHPQQPQPQRYAPP
PQQPEPRREPRQRSSNPNRMKIPGLGCLKGCLFVIVVLVIGSWLVWELTPLKDWVAEGKG
YWDAVSGWAKDVGQWIEDLGGPSS
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
gtgcggccggtaggcagcaaatacctgctcgaggagccgctcgggcgcggagccacgggc
accgtctggcgtgcccgccagaccacgccggcgggggccgaggccgccgtggccgggcag
cccggcgagactgtcgcgatcaaggtcctcaaggaggagctcgcgaacgacgcggacatc
gtgatgcgctttctccgcgagcgctcggtgctgctccggctcacccaccccaatatcgtc
cgcacccgtgacctggtggtcgagggcgatctgctggccctggtcatggacctgatcgac
ggcccggatctgcacaactacctgcgcagcaacggcccgttcacccccgtcgccgcctcc
ctcctcaccgcgcagatcgccgacgcgctcgccgccagccacgccgacggcgtggtgcac
cgcgatctgaagcccgccaacgtgctgctcgcgggcaccggcgagggccaggagatgcac
ccgatgctgaccgacttcggcatcgcgcgcctcgccgactcgcccggcctcacccgcacc
caggagttcgtcggcacccccgcctatgtggcgccggagtccgccgagggccgtccgcag
acctccgcggtggacatctacggcgcgggcatcatgctctacgagctggtcacgggccgt
ccgccgttcgccggcaacaccgcactcgaggtgctccaccgccacctcagcgaggagccg
cgccgcccctcgaccgtgcccgagccgctgtggacggtgatagagcgctgtctgcgcaag
cggcccgaggagcgccccagcgccgagaacctcgcccgtgggctgcgcgtggtcgccgcg
ggtgtcggggtgcacgcctcggccgcgcaggccgaggaggcgctcggcgtggccgcgctg
ctcgccccggacccggcgcccgccccggtgccggacaccgcgcccgcgggctcggccgag
cccacgcaggtgctgcccacgaacgcaccggcgggctccccctcgtacgacccggccgcg
gccaccaatgtgatgccgaccgccggggcgaacgccgaccccacccaggtgctgcccagc
ggctccggaccggccggaggccccgatccgacgcgcgccatgccgcccgtgccgcccggt
ggtccgggccaggacgatccgcacccctggcagaaccagctgcgcgcggcccgcgaccgc
aatgagcagacccaggtccagtacctcgaccccagccaggacccgctgcgccgccgcccc
caacgccccgcgccccagcagtaccagcagccgcagcagtaccagcagccccagcagcag
ccgccccagcgccagcggggccgccagcagccgccgccgtacgcccagcagcagccgcag
cagtacgccccggcgccgcaccacccccagcagccccagccgcagcgctacgccccgccg
ccgcagcagccggagccgcgccgcgagccccgccagcggagctccaaccccaaccggatg
aagatcccggggctggggtgcctcaagggctgtctgttcgtgatcgtggtcctggtcatc
ggctcctggctggtctgggagctgaccccgctcaaggactgggtcgccgagggcaagggc
tactgggacgcggtctcgggctgggccaaggacgtcgggcagtggatcgaggacctgggc
gggcccagcagctga

DBGET integrated database retrieval system