KEGG   Streptomyces malaysiensis: SMALA_3375Help
Entry
SMALA_3375        CDS       T05189                                 

Definition
(GenBank) succinic semialdehyde dehydrogenase
  KO
K00135  succinate-semialdehyde dehydrogenase / glutarate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.79 1.2.1.20]
Organism
smal  Streptomyces malaysiensis
Pathway
smal00250  Alanine, aspartate and glutamate metabolism
smal00310  Lysine degradation
smal00350  Tyrosine metabolism
smal00650  Butanoate metabolism
smal00760  Nicotinate and nicotinamide metabolism
smal01100  Metabolic pathways
smal01120  Microbial metabolism in diverse environments
Module
smal_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:smal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SMALA_3375
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SMALA_3375
   00310 Lysine degradation
    SMALA_3375
   00350 Tyrosine metabolism
    SMALA_3375
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    SMALA_3375
Enzymes [BR:smal01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     SMALA_3375
    1.2.1.20  glutarate-semialdehyde dehydrogenase
     SMALA_3375
    1.2.1.79  succinate-semialdehyde dehydrogenase (NADP+)
     SMALA_3375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ATL83609
UniProt: A0A291SRS4
LinkDB All DBs
Position
complement(4347856..4349466)
Genome map
AA seq 536 aa AA seqDB search
MTDSHITQDGTGNPVAPEGTRTAADVVTPELITRLTRGVVGSGTTVSHTPFTGEVLASAL
PESTPEDVATAFGCARAAQRAWAATPVRRRAAVLLRFHDLLLSRQPEILDLIQLETGKTR
LHAQEEVQGVAIVARHYGRKAPAYLRPKGHLGAVPTLTKVTELRQPRGVVGLIAPWNYPL
QLSVGDAIPAFVAGNAVVMKPDTETALSALWARELMVEAGLPAGVWQIVIGDGPVVGPAV
VEGADYVSFTGSTRTGREVARAAAARLVGCSLELGGKNAMLVLHDADLDRAVDGAVRGSF
ASAGQLCISMERLYVHESIADTFLERFAARTKAMRLGTALAYGAEMGSLVSERQLETVTR
HVDEAVAKGATVLAGGRPRPDIGPYFYEPTILDGVESPMAVCTEETFGPVVSVYRFGDED
EAIVRANATAYGLNASVWTKDARRGRAIAARLRAGTVNLNESYAAAFGSVASPMGGMGDS
GLGRRHGSEGILRFTEPQTVAQQRLMPLGPAFGMTDEKYADFMTRSLRALKALRLR
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgacggactcgcacataacgcaggacggcaccggtaacccggtcgcccccgaaggcacc
cgcaccgcggccgacgtcgtcaccccggagctgatcacccggctcacccggggcgtcgtc
ggcagcggcaccaccgtcagccacaccccgttcaccggggaagtgctcgcctccgccctg
cccgagtccacccccgaggatgtcgccaccgccttcggatgcgcccgcgccgcccagcgg
gcctgggctgcgacccccgtacgccggcgcgccgccgtcctcctccgcttccacgatctg
ctgctgagccgccagccggagatcctggacctgatccagctggagaccggcaagacccgg
ctgcacgcccaggaggaggtccagggcgtcgccatcgtggcccgccattacggccgtaag
gcgcccgcgtatctgcgccccaaggggcatctgggcgcggtgcccaccctcaccaaggtc
accgaactgcgccagccgcgcggcgtcgtcggcctcatagcgccctggaactaccccctc
cagctctccgtgggcgatgcgatacccgccttcgtggcgggcaacgccgtcgtgatgaag
cccgacaccgagaccgcgctgtccgccctgtgggcgcgtgagctgatggtggaggccggg
ctgccggccggggtgtggcagatcgtgatcggggacggcccggtggtcggccccgccgtg
gtcgagggcgccgactacgtctcgttcaccggctccacccgcaccggccgcgaagtggcc
cgggccgccgccgcccgcctggtgggctgctccctcgaactcggcggtaagaacgccatg
ctggtgctgcacgacgcggatctcgaccgcgcggtcgacggcgcggtgcgcggcagcttc
gcctccgccgggcagctgtgcatctccatggagcggctgtacgtccacgagtcgatcgcg
gacaccttcctggagcgcttcgcggcccgtacgaaggccatgcggctcggcaccgccctc
gcctacggcgcggagatgggctcgctcgtctccgagcgtcagctggagaccgtcacccgc
catgtggacgaggccgtcgccaagggcgccacggtgctcgccggcggccgcccccgcccc
gacatcggcccgtacttctacgagccgacgatcctggacggcgtggagtccccgatggcc
gtctgcaccgaggagaccttcggcccggtcgtctccgtctaccgcttcggcgacgaggac
gaggcgatcgtgcgcgccaacgccaccgcctacggcctgaacgccagcgtctggaccaag
gacgcccggcgcggacgcgcgatcgccgcccggctgcgcgcgggcacggtcaacctcaac
gagagctacgccgccgccttcggcagcgtcgcctctccgatgggcggcatgggcgactcc
gggctcggccgccgccatggctccgagggcatcctccggttcaccgaaccgcagacggtc
gcccagcagcggctgatgccgctcggcccggccttcgggatgacggacgagaaatacgcg
gacttcatgacccgcagcctgcgcgcgctcaaggcactgcgcctgcgctga

KEGG   Streptomyces malaysiensis: SMALA_6229Help
Entry
SMALA_6229        CDS       T05189                                 

Definition
(GenBank) succinate-semialdehyde dehydrogenase (NAD(P)(+))
  KO
K00135  succinate-semialdehyde dehydrogenase / glutarate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.79 1.2.1.20]
Organism
smal  Streptomyces malaysiensis
Pathway
smal00250  Alanine, aspartate and glutamate metabolism
smal00310  Lysine degradation
smal00350  Tyrosine metabolism
smal00650  Butanoate metabolism
smal00760  Nicotinate and nicotinamide metabolism
smal01100  Metabolic pathways
smal01120  Microbial metabolism in diverse environments
Module
smal_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:smal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SMALA_6229
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SMALA_6229
   00310 Lysine degradation
    SMALA_6229
   00350 Tyrosine metabolism
    SMALA_6229
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    SMALA_6229
Enzymes [BR:smal01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     SMALA_6229
    1.2.1.20  glutarate-semialdehyde dehydrogenase
     SMALA_6229
    1.2.1.79  succinate-semialdehyde dehydrogenase (NADP+)
     SMALA_6229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ATL86457
UniProt: A0A291T023
LinkDB All DBs
Position
7665585..7666994
Genome map
AA seq 469 aa AA seqDB search
MAVHQINSVNPATEEVIAQFTPHSPTAVDAAVERASLAARRWRTIPAPARAEHLKRAAAL
LRAERDQLAALITEEMGKPIAEAEAEVDKSAWACEYYATQGPELLMHQPVATGAARSHVA
FDPLGLVLAVMPWNYPLWQVFRFAPPALLAGNGIVLKHASNVPRCALAIADIWNRAGCPD
GLFTTLLVGPDAVPDLIADPRIHALTLTGSTEVGSTVAAMAARHLKPQVLELGGSDPFIV
LADADIPAAAAAAVSARMLNTGQSCISAKRFIVEEAVAEEFTDAFAAGVAALTVGDPFRR
DVRIGPLARSALRDDLVDQVQRSTAAGARIVTGGTVLDGPGYFYVPAVLDQVTPTMAVAA
EETFGPVAAVVSAKDPAQAVDIANATEFGLGAALWTTDLDRADRLIPGIEAGAVFVNGIV
ASDPRLPFGGIKRSGYGRELGAFGLRQFTNVKSVWIGPAHNAQSHPLSE
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggccgttcaccagatcaactccgtcaacccggccaccgaggaagtcatcgcccagttc
accccccactcgccgacagctgtcgacgcggcagtcgagcgggcatccctcgccgccagg
aggtggcggacgatacccgcaccggcacgggccgagcacctcaagcgggccgccgcgcta
ctgcgcgccgaacgggaccaactcgccgcactcatcaccgaggagatgggcaagcccatc
gccgaagcggaagccgaggtcgacaagtccgcctgggcttgcgagtactacgcgacgcag
ggaccggaactactgatgcaccagcccgtggcaaccggggccgcccgcagccacgtcgcc
ttcgacccgctgggcctcgtcctggcagtcatgccctggaactatccgctctggcaggtg
ttccgctttgcgccgcccgcgctgctggccggcaacgggatcgtgctcaagcatgcctcg
aacgtcccgcgctgcgccctggcgatcgcggacatctggaaccgggccggctgcccggac
gggctgttcaccacactgctcgtcggccctgacgcggtgccggacctcatcgccgacccg
cgcatccacgccctgaccctcaccggctcgaccgaagtaggctccaccgtcgccgcgatg
gccgcccgacacctcaagcctcaggtcctcgaactcggcggctccgaccccttcatcgtc
ctcgcggacgcggacatcccggccgccgcggcggcagcggtcagcgcacgcatgctcaac
accgggcagagctgcatctccgccaagaggttcatcgtcgaggaagcagtcgccgaggag
ttcaccgacgccttcgctgccggtgtcgccgcactgaccgtgggcgaccccttccgccgc
gatgtgcggatcggccctctcgcccggtccgctctccgcgacgacctcgtcgaccaggtc
cagcgcagtaccgcagcgggcgcccgtatcgtcaccggcggcacggtcctcgacggccct
ggttacttctacgtgcccgctgtcctggaccaggtcacccccacgatggccgtcgcagcg
gaagagacgttcgggccggtggccgccgtcgtctccgcgaaggatccggcccaggccgtc
gacatcgccaacgccaccgaattcggtctcggcgccgcgctctggacaaccgacctcgat
cgcgccgatcgcctgattcccggtatcgaggccggcgccgtgttcgtcaacgggatcgtc
gcctccgatccgcggctgccgttcggcggcatcaagcgcagcggctacggacgcgagctg
ggcgccttcggactccgtcagttcaccaacgtcaagagcgtgtggatcggccccgcacac
aatgcacagagccaccccctcagcgaatga

KEGG   Streptomyces malaysiensis: SMALA_6234Help
Entry
SMALA_6234        CDS       T05189                                 

Definition
(GenBank) succinate-semialdehyde dehydrogenase (NAD(P)+)
  KO
K00135  succinate-semialdehyde dehydrogenase / glutarate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.79 1.2.1.20]
Organism
smal  Streptomyces malaysiensis
Pathway
smal00250  Alanine, aspartate and glutamate metabolism
smal00310  Lysine degradation
smal00350  Tyrosine metabolism
smal00650  Butanoate metabolism
smal00760  Nicotinate and nicotinamide metabolism
smal01100  Metabolic pathways
smal01120  Microbial metabolism in diverse environments
Module
smal_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:smal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SMALA_6234
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SMALA_6234
   00310 Lysine degradation
    SMALA_6234
   00350 Tyrosine metabolism
    SMALA_6234
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    SMALA_6234
Enzymes [BR:smal01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     SMALA_6234
    1.2.1.20  glutarate-semialdehyde dehydrogenase
     SMALA_6234
    1.2.1.79  succinate-semialdehyde dehydrogenase (NADP+)
     SMALA_6234
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ATL86462
UniProt: A0A291T001
LinkDB All DBs
Position
7671043..7672446
Genome map
AA seq 467 aa AA seqDB search
MENPATGEPVARVADAGTTDALDALGAAAGAQSQWAATSPGQRSCILRRTHDLLLERRED
FAGLITLEMGKSLAEARAEVDYAAGYLRWFAEEAVRIDGTWKVSEDATARVLVVRQPVGP
CLLITPWNAPLAMPARKIAPAVAAGCTMVLKPAPQTPLTSIALATVLIEAGLPAGVLNLL
PTADAAAVSEALMKDPRLRKVSFTGSTAVGRLLLAQASANVLRTSMELGGNAPFIVCADA
DLQAAVDGAMTAKLRNIGEACIAANRFLVHADIAQEFTEHLVDRMRGLTLGSGTEPGTDL
GPLIDRTQRDRVAQLVEETIAGGARLHTGGSTPDLPGYFYPPTVLTDIPDGARISREEIF
GPVAAIRTFSSDDEALTMANATEFGLVAYLYTRDLGRALRMSEQIESGMVGLNRGYVSDP
GAPFGGIKHSGAGREGGNSGIEEYLEQKYIAIETPADAGTPATQDPS
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
gtggagaaccccgcgacgggcgaaccggtagcccgggtcgccgatgccggcaccacggac
gcactcgacgccctcggcgcggctgccggggcgcagtcgcagtgggccgcaacatcgccg
ggacagcgcagctgcattctgcgccgcacccacgacctgctgctggagcgccgtgaggac
ttcgcggggctcatcactctggagatgggcaagtccctcgccgaggcccgtgcggaagtc
gattacgcggccggatacttgcgctggttcgccgaggaagccgtccgcatcgacgggacc
tggaaagtcagcgaggacgcaacggcaagggtcctggtcgtgcgccagcccgtcggaccg
tgcctgctgatcacgccctggaacgcgcctctggcgatgccggcccgtaagatcgccccc
gctgtggccgccggctgcacgatggtcctcaagcccgccccgcagaccccgctcaccagc
atcgcactggccacagtcctgatcgaggccggcctgcccgccggcgttttgaacctcctt
cccaccgccgacgctgctgcggtgtccgaggcactgatgaaggatccgcggctgcgcaag
gtctccttcaccggctccaccgcggtcggccggctgctgctggcccaggcatccgccaac
gtactgcgcacctcgatggagctgggcggcaatgccccgttcatcgtgtgcgccgacgcc
gacctgcaagcggcggtggacggcgccatgaccgcgaagctgcgcaacatcggcgaagcg
tgcatcgcggcgaaccgcttcctcgttcatgccgacatcgcgcaggaattcaccgagcat
ctcgtggaccggatgcgcggcctgactctcggcagcggaacggaacccggtaccgacctc
ggcccgctgatcgaccgcacccagcgcgaccgtgtcgcccagctggtggaggagaccatc
gccggcggcgcgcggctgcacaccggcggcagcacccccgacctgcccggctacttctat
ccgcccaccgtgctcaccgacatccccgacggcgcacgcatcagccgcgaggagatcttc
ggccccgtcgccgccatccggaccttctccagcgacgacgaggccctcacgatggccaac
gccaccgagttcggcctggtcgcctacctctacacccgcgatctcggccgagcactgcgg
atgagcgaacagatcgagagcggcatggtcggcctcaaccgcggctacgtctccgaccct
ggggcacccttcggcggcatcaagcattcaggtgccggccgcgagggcggcaactccggc
atcgaggaatacctggagcagaagtacatcgccatagagacccccgccgacgccggtacc
cccgccacccaggacccgtcatga

KEGG   Streptomyces malaysiensis: SMALA_7376Help
Entry
SMALA_7376        CDS       T05189                                 

Definition
(GenBank) succinate-semialdehyde dehydrogenase (NAD(P)+)
  KO
K00135  succinate-semialdehyde dehydrogenase / glutarate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.79 1.2.1.20]
Organism
smal  Streptomyces malaysiensis
Pathway
smal00250  Alanine, aspartate and glutamate metabolism
smal00310  Lysine degradation
smal00350  Tyrosine metabolism
smal00650  Butanoate metabolism
smal00760  Nicotinate and nicotinamide metabolism
smal01100  Metabolic pathways
smal01120  Microbial metabolism in diverse environments
Module
smal_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:smal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SMALA_7376
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SMALA_7376
   00310 Lysine degradation
    SMALA_7376
   00350 Tyrosine metabolism
    SMALA_7376
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    SMALA_7376
Enzymes [BR:smal01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     SMALA_7376
    1.2.1.20  glutarate-semialdehyde dehydrogenase
     SMALA_7376
    1.2.1.79  succinate-semialdehyde dehydrogenase (NADP+)
     SMALA_7376
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA DUF1487
Motif
Other DBs
NCBI-ProteinID: ATL87593
UniProt: A0A291T386
LinkDB All DBs
Position
9146529..9148001
Genome map
AA seq 490 aa AA seqDB search
MSTPSYPSAAEVLAAVPKQLHIAGSWSDAAGGRTMPVDDPATGEVLCEVADAAPADGQRA
LAAAEDAQEKWAATAPRVRSEILRRAYELITERADALAALMTAEMGKPLAEARGEAAYAA
EFFRWFSEEAVRIEGGFATLPDGRNRMLLMRRPVGPCLLITPWNFPLAMGTRKIGPAIAA
GCTMVLKPAPQTPLSSLALAGILAEAGLPAGVLNVVTTSRAGEVVEPLLTGGHVRKLSFT
GSTQVGRTLLAQCAPAVVRTSMELGGNAPFIVFEDADLDTAVEGAMTAKMRNMGEACTAA
NRFFVHSSVAAEFADRLARRMGALEVGPGSRPGVDVGPLIDRAGRTKVEELVADAVARGA
EVLVGGSAPDGPGCFYPPTVLTGVSPASRLMETEIFGPVAAVLTFDDEDEVVATANHTEW
GLVGYVFTQDLGRSLRVSERLEVGMVGLNTGLVSNPAAPFGGVKQSGLGREGGRVGIDEF
LEYKYVAVPV
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccccctcgtacccctcggccgccgaggtcctcgccgcggtgcccaagcagctc
cacatcgccgggtcatggtccgacgcggccggcggccggaccatgccggtcgacgacccg
gccaccggtgaggtgctgtgcgaggtcgccgacgccgccccggccgacgggcagcgggcc
ctggccgccgccgaggacgcccaggagaagtgggcggccaccgcgccccgcgtacgcagc
gagatcctgcgccgcgcctatgagctgatcacggagcgggccgacgcgctcgccgcgctg
atgacggccgagatgggcaagccgctggccgaggcgaggggggaggcggcctacgccgcg
gagttcttccgctggttctccgaggaggccgtgcggatcgagggcgggttcgccacgctg
ccggacggccggaaccgcatgctgctgatgcgccgcccggtcggcccctgtctgctcatc
acgccgtggaacttcccgctggccatgggcacccgcaagatcggcccggcgatcgccgct
ggctgcaccatggtgctcaagcccgccccgcagaccccgctgtccagcctcgcgctcgcc
ggcatcctggcggaggcggggcttccggccggggtgctcaacgtggtcaccacctcccgt
gcgggcgaggtcgtcgagccgctgctgaccggcggacatgtccgcaagctctccttcacc
ggctccacccaggtcggccgtaccctgctggcccagtgcgcgcccgcggtggtccgcacc
tccatggaactgggcggcaacgcccccttcatcgtcttcgaggacgccgacctcgacacc
gcggtcgagggcgccatgaccgccaagatgcgcaacatgggcgaggcgtgcacagcggcc
aaccggttcttcgtccactcctccgtcgcggccgagttcgccgaccggctcgcccgccgc
atgggcgcgctggaggtcggccccggcagccggcccggtgtcgacgtggggccgctcatc
gaccgggccggccgtaccaaggtcgaggaactggtcgcggacgccgtggcgcgcggcgcc
gaggtcctggtcgggggcagcgccccggacggccccggctgcttctacccgcccacggtg
ctcaccggcgtctccccggccagccggctgatggagaccgagatcttcggaccggtggcg
gccgtcctcaccttcgacgacgaggacgaggtcgtcgccaccgccaaccacaccgaatgg
ggcctggtgggctatgtgttcacccaggacctgggccgctcgctgcgggtgagcgagcgg
ctcgaggtcggcatggtcggcctcaacaccggtctggtctccaaccccgcggcccccttc
ggcggcgtcaagcagtccgggctcggccgtgagggcggccgcgtcggcatcgacgagttc
ctggagtacaagtacgtcgcggtgccggtctga

KEGG   Streptomyces malaysiensis: SMALA_7631Help
Entry
SMALA_7631        CDS       T05189                                 

Definition
(GenBank) putative succinate-semialdehyde dehydrogenase (NADP+)
  KO
K00135  succinate-semialdehyde dehydrogenase / glutarate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.79 1.2.1.20]
Organism
smal  Streptomyces malaysiensis
Pathway
smal00250  Alanine, aspartate and glutamate metabolism
smal00310  Lysine degradation
smal00350  Tyrosine metabolism
smal00650  Butanoate metabolism
smal00760  Nicotinate and nicotinamide metabolism
smal01100  Metabolic pathways
smal01120  Microbial metabolism in diverse environments
Module
smal_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:smal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SMALA_7631
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SMALA_7631
   00310 Lysine degradation
    SMALA_7631
   00350 Tyrosine metabolism
    SMALA_7631
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    SMALA_7631
Enzymes [BR:smal01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     SMALA_7631
    1.2.1.20  glutarate-semialdehyde dehydrogenase
     SMALA_7631
    1.2.1.79  succinate-semialdehyde dehydrogenase (NADP+)
     SMALA_7631
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ATL87847
UniProt: A0A291T3Z5
LinkDB All DBs
Position
9563670..9565148
Genome map
AA seq 492 aa AA seqDB search
MNLPGIETLVKAPFAEGDVFIAGRWCAAEDGRTFPVHDPATAELIREVSAAGPGDAMAAV
DAARAAAAGWRSTPPRRRSEILHTAFALMRENTETLARLIVLENGKAYRDAVAEVGYAAE
FFRWFAEEAVRIGSSFGDAPAGGFRHVVRRHPVGVTAFVTPWNFPAAMATRKIAPALAAG
CPVLLKPAPDTPLTALAIAALLSEAGLPDGLLNVLPTDRAPEVVSAWLRDERVRKFSFTG
STATGRKLLEQAASNVVNVTMELGGNAPFIVCEDADVDAAVRGAMDAKMRGGGEVCIAAN
RFYVHRSVAAEFTEKFAAAMTAVRAGAGLEEGVTLGPMVNRTAVESIRSLVDDAIERGAK
VAARGEVPEGPGHYHPATVLVDVPEDARIMNEEVFGPVAPLATFADEDELVARANDTVHG
LASYIYSRDVGRALRIAERLETGMVGLNRGLLSDPAAPFGGVKQSGLGREGGREGIEAFL
ETQYIALDWPTD
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgaacctccccggcatagaaaccctcgtcaaggcgccgttcgccgaaggcgatgtgttc
atcgccggccgctggtgcgcggccgaggacggacggacgtttccggtacacgacccggcc
accgcggagttgatccgcgaggtgtccgcggcgggcccgggcgacgccatggcggcggtc
gacgcggcccgggcggccgccgccggatggcggtcgacaccgccacgccgtcgctcggag
atcctgcacacggcgttcgcgctgatgcgcgagaacaccgagacgctcgcccgcctgatc
gtcctggaaaacggcaaggcgtaccgggacgcggtggccgaggtcggctacgcggcggag
ttcttccgctggttcgccgaggaggcggtacggatcggctcctcgttcggcgacgcaccg
gctggcggtttccggcatgtcgtacgcaggcatccggtgggcgtcaccgccttcgtcaca
ccgtggaacttcccggccgcgatggccacccggaagatcgcccccgcgctcgccgccggc
tgcccggtgctcctcaaaccggccccggacaccccgctcaccgccctcgcgatcgccgcc
ctgctgagcgaggcgggcctgcccgacgggctgctgaacgtcctgccgaccgaccgcgcg
cccgaggtggtctccgcctggctccgcgacgagcgggtccgcaagttctccttcaccggc
tccaccgccaccggccggaaactcctggagcaggcggcgtcgaacgtcgtcaacgtgacc
atggaactgggcggcaacgcccccttcatcgtctgcgaggacgccgatgtcgacgccgcg
gtgcgcggtgcgatggacgccaagatgcggggcggtggcgaggtgtgcatcgccgccaac
cggttctacgtccatcggtccgtcgccgccgagttcaccgagaagttcgcggcggccatg
accgcggtacgcgccggagcgggtctggaggagggcgtcaccctcggccccatggtcaac
cgcaccgccgtggaatccatccgctccctggtcgacgacgcgatcgaacgcggtgcgaag
gtcgccgcccggggcgaggtgcccgaaggccccggccactaccacccggccaccgtcctg
gtggacgtccccgaggacgcccggatcatgaacgaggaggtcttcgggccggtggcgcca
ctggccaccttcgccgacgaggacgagctggtggcccgcgccaatgacacggtgcacggc
ctcgcctcctacatctactcgcgcgacgtgggccgggccctgcgcatcgccgaacgcctg
gaaaccggcatggtcggcctcaaccggggcctgctgtccgacccggcggcgcccttcggc
ggcgtcaagcagtcgggcctgggccgggagggcggccgcgagggcatcgaggcgttcctg
gagacgcagtacatcgccctcgactggcccaccgactga

DBGET integrated database retrieval system