KEGG   Streptomyces malaysiensis: SMALA_3593Help
Entry
SMALA_3593        CDS       T05189                                 

Definition
(GenBank) glutamate decarboxylase beta
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
smal  Streptomyces malaysiensis
Pathway
smal00250  Alanine, aspartate and glutamate metabolism
smal00410  beta-Alanine metabolism
smal00430  Taurine and hypotaurine metabolism
smal00650  Butanoate metabolism
smal01100  Metabolic pathways
smal01110  Biosynthesis of secondary metabolites
smal01120  Microbial metabolism in diverse environments
smal02024  Quorum sensing
Module
smal_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:smal00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    SMALA_3593
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SMALA_3593
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SMALA_3593
   00430 Taurine and hypotaurine metabolism
    SMALA_3593
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    SMALA_3593
Enzymes [BR:smal01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     SMALA_3593
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ATL83827
UniProt: A0A291SSH6
LinkDB All DBs
Position
4604620..4606029
Genome map
AA seq 469 aa AA seqDB search
MALHKGTPGPRRDERSEFSTNPVYDEANPVSGMTGKPPRHCLPDGPMAPTTAYQFVHDEL
MLDGNARQNLATFVTTWMEPQAGKLMSDCLAKNMIDKDEYPRTAELERRCVAMLGHLWHA
PDPDAVVGCSTTGSSEACMLAGMAFKRRWAKRNPVSYPATARPNLVMGTNVQVCWEKFCD
FWEVEARQVPMEGNRFHLDPQAAAELCDENTIGVVAVLGSTFDGSYEPVAEVCRALDDLQ
ERTGLDIPVHVDGASGAMIAPFLDPDLRWDFQLPRVASINTSGHKYGLVYPGVGWALWRT
AEVLPEDLVFRVDYLGGDMPTFSLNFSRPGSQVAAQYYTFVRLGRAGYRAVQQEARDVAC
SLAERIEAFGDFTLLSRGDQLPVFAFTTAEGVGAFDVYDVSRRLRERGWLVPAYAFPPNR
QDLSVLRVVCRNGFSEDLADLFLADLGSLLPELRSQPAPTGKTVTAFHH
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
gtggcacttcataaaggcactcccggcccacgccgggacgaacgctccgagttctccacc
aacccggtctacgacgaggccaatccggtcagcgggatgaccggcaaacccccgcgccac
tgcctccccgacgggccgatggcgcccacgaccgcgtatcagttcgtccatgacgagctg
atgctggacggcaacgcccgccagaacctcgccaccttcgtcaccacgtggatggagccg
caggcgggcaagctgatgtccgactgcctcgccaagaacatgatcgacaaggatgagtac
ccgcgcaccgccgaactggaacggcggtgcgtggcgatgctcggccatctgtggcacgca
cccgacccggacgccgtcgtgggctgctccaccacggggtcgagcgaggcgtgcatgctg
gccggaatggccttcaagcggcgctgggccaaacggaacccggtgagctatccggcgacc
gcccgccccaacctggtcatggggaccaatgtccaggtgtgctgggagaagttctgcgac
ttctgggaggtggaggcgcggcaggtgcccatggagggcaaccggttccacctcgatccc
caggccgccgccgaactgtgcgacgagaacaccatcggcgtcgtggcggtcctcggctcc
accttcgacggctcctacgaacccgtcgccgaggtgtgccgggcgctggacgacctccag
gagcgcacgggcctggacatcccggtgcatgtggacggcgcctcgggcgcgatgatcgcg
ccgtttctcgacccggacctgcggtgggacttccagctgccgcgggtcgcctccatcaac
acctcgggccataagtacggcctggtctaccccggggtggggtgggcgctgtggcgtacg
gcggaggtgctgcccgaggatctggtcttccgcgtcgactacctcggcggcgacatgccg
acgttctcgctcaacttctcccgccccggctcccaggtggccgcccagtactacaccttc
gtacggctgggccgggcgggctaccgcgccgtccagcaggaggcgcgcgatgtggcgtgc
tcgctcgccgagcggatcgaggcgttcggggacttcaccctgctgagccgcggcgatcag
ctgccggtgttcgccttcaccacggcggagggggtcggcgccttcgatgtctacgacgtc
tcccggcggctgcgcgaacgcggctggctggtgcccgcgtacgccttcccgcccaaccgg
caggacctgtccgtgctgcgggtggtgtgccgcaacggcttctcggaggacctcgccgat
ctcttcctggcggacctcgggtcgctgctgcccgagctgcggtcacagcccgcgcccacg
gggaagaccgtcacggcgttccaccactga

DBGET integrated database retrieval system