KEGG   Streptomyces malaysiensis: SMALA_3599Help
Entry
SMALA_3599        CDS       T05189                                 

Definition
(GenBank) putative aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
smal  Streptomyces malaysiensis
Pathway
smal00010  Glycolysis / Gluconeogenesis
smal00053  Ascorbate and aldarate metabolism
smal00071  Fatty acid degradation
smal00280  Valine, leucine and isoleucine degradation
smal00310  Lysine degradation
smal00330  Arginine and proline metabolism
smal00340  Histidine metabolism
smal00380  Tryptophan metabolism
smal00410  beta-Alanine metabolism
smal00561  Glycerolipid metabolism
smal00620  Pyruvate metabolism
smal00625  Chloroalkane and chloroalkene degradation
smal00903  Limonene and pinene degradation
smal01100  Metabolic pathways
smal01110  Biosynthesis of secondary metabolites
smal01120  Microbial metabolism in diverse environments
smal01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:smal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMALA_3599
   00053 Ascorbate and aldarate metabolism
    SMALA_3599
   00620 Pyruvate metabolism
    SMALA_3599
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SMALA_3599
   00561 Glycerolipid metabolism
    SMALA_3599
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SMALA_3599
   00310 Lysine degradation
    SMALA_3599
   00330 Arginine and proline metabolism
    SMALA_3599
   00340 Histidine metabolism
    SMALA_3599
   00380 Tryptophan metabolism
    SMALA_3599
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SMALA_3599
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SMALA_3599
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SMALA_3599
Enzymes [BR:smal01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SMALA_3599
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ATL83833
UniProt: A0A291SSI1
LinkDB All DBs
Position
complement(4611173..4612630)
Genome map
AA seq 485 aa AA seqDB search
MSYFSELALQFIDGEWRGGSGSWDIVDFNPYNGEKLASITVATVEEVDLAYRAAERAQPE
WGATNPYARRAVFERVLRIIEDREKELTETIIAECGGTHVKAGFELHLAKEFLREAIHLA
LRPEGRILPSPVDGKENRLYRLPVGVVGVISPFNFPFLLSLKSVAPALALGNAVVLKPHQ
NTPVCGGGLVAKIFEEAGLPAGLLNVVITDIAEIGDALIEHPIPKVLSFTGSDKVGRHVA
TVAASHFKRTVLELGGNSALVVLDDADLDYAVDAAVFSRFVHQGQVCMAANRVLVDRAIE
REFTERFVAKVETLKVGDPGDPTTHIGPLINEGQAEAIAQLVDQTIAEGATALVRGRTEG
SLMGPTVLSGVPEGSAILGQEVFGPVVTLIPFDGDDEAVRIANDTDYGLSGGVHTSDIER
GVRFAQRVHTGMIHVNDSTVHDEPIVPFGGEKHSGLGRLNGESMIEDFTTTKWISIQHGR
SQFPF
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtcctacttctccgagttggcccttcagttcatcgacggcgagtggcgcggcggaagc
ggttcctgggacatcgtcgacttcaacccctacaacggggagaagctggcctccatcacc
gtggcgaccgtcgaggaggtggacctcgcctaccgggcggccgagcgggcgcagccggag
tggggcgccaccaacccctatgcccggcgggcggtcttcgagcgggtgctgcggatcatc
gaggaccgtgagaaggagctcaccgagacgatcatcgcggagtgcggcggcacccatgtg
aaggcgggtttcgagctgcacctcgccaaggagttcctgcgcgaggcgatccacctcgcg
ctgcggcccgagggccgcatcctgccgtcgccggtcgacggcaaggagaaccgcctctac
cggctgccggtgggcgtggtcggtgtgatcagcccgttcaacttcccgttcctgctgtcg
ctgaagtcggtcgcccccgcgctggccctcggcaacgccgtcgtcctcaagccccaccag
aacaccccggtctgcggcggcggcctggtcgccaagatcttcgaggaggccgggctgccc
gccgggctgctcaatgtcgtgatcaccgacatcgcggagatcggtgacgccctgatcgag
caccccataccgaaggtgctctccttcaccggctccgacaaggtcggccggcacgtcgcc
accgtggccgcctcccacttcaagcgcacggtcctggagctgggcggcaacagcgcgctg
gtcgtgctcgacgacgccgatctggactacgcggtggacgcggccgtcttcagccgcttc
gtccaccaggggcaggtctgcatggcggccaaccgggtgctggtggaccgggcgatcgag
cgggagttcaccgagaggttcgtggccaaggtggagacgctgaaggtgggcgacccgggc
gaccccaccacccatatcggcccgctgatcaacgagggccaggccgaggcgatcgcccag
ctcgtcgaccagacgatcgccgagggcgccaccgcgctggtccgggggcgcaccgagggc
agcctgatggggccgaccgtgctcagcggggtcccggaggggtcggcgattctcggccag
gaggtcttcggcccggtggtgacgctgatcccgttcgacggcgacgacgaggccgtgcgg
atcgccaatgacacggactacgggctcagcggcggcgtgcacaccagcgacatcgagcgc
ggggtgcggttcgcccagcgggtccacaccggcatgatccatgtgaacgacagcacggtc
cacgacgagccgatcgtgccgttcggcggcgagaagcactccggtctcggtcggctcaac
ggggagtcgatgatcgaggacttcaccaccaccaagtggatctccatccagcacggccgg
agccagttcccgttctga

DBGET integrated database retrieval system