KEGG   Streptomyces malaysiensis: SMALA_4104Help
Entry
SMALA_4104        CDS       T05189                                 

Definition
(GenBank) hydrolase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
smal  Streptomyces malaysiensis
Pathway
smal00380  Tryptophan metabolism
smal01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smal00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    SMALA_4104
Enzymes [BR:smal01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     SMALA_4104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Cys_Met_Meta_PP ssDBP
Motif
Other DBs
NCBI-ProteinID: ATL84337
UniProt: A0A291STX9
LinkDB All DBs
Position
5183525..5184931
Genome map
AA seq 468 aa AA seqDB search
MSDATIPTESAGAEPTGTEAEVNGAGTESAGVEPTGTRPAPAESAPAESAPAGTGAAEPG
LTEDETILPPAALTDEAARLDAADRLRAKRDAFTLDDVIYLDGNSLGALPRAVPPRLADV
VAREWGQLRIRSWEESGWWTAPERIGDRVGRLVGAAPGQVVVGDSTSVNVFKAVVAAVRM
AQERGAHRDQILVDEATFPTDGYIAESAARMTGCTLRPVAAGDIPSAVGSRTAVALVNHV
DYRTGRLHDLPGTTAAVHAAGALVVSDLCHSAGALPVGLDAHGVDLAVGCTYKYLNGGPG
APAYLYVARAHQPGFDSPLPGWNSHADPFGMASAYTPADGAVRGRVGTPDILSMLALEAA
LEVWDDVTIEDVRAKSLALTDFFLRCVEEYAPAGRVRSLTPAAHTERGSQVALRCADAGE
VMAELVRRGVVGDFRRPDVLRFGFTPLYTGFAEVERAARVLAAVLKEG
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacgcgacgatccccacggagtcggccggggccgagccgaccggtaccgaagcc
gaggtgaacggtgctggaaccgagtcggccggtgttgagccgaccggcacgcggcccgct
ccggctgagtccgctccggctgagtccgctcccgctgggacgggtgcggccgagcccggt
ctgaccgaggacgagaccattctgcccccggccgccctcaccgacgaggccgccaggctc
gacgcggccgaccggctgcgcgccaagcgcgacgccttcaccctcgacgacgtcatctac
ctcgacggcaactcactgggtgccctgccgcgcgccgtcccgccccggctggccgatgtg
gtcgcccgcgaatgggggcagctgcgcatccgctcctgggaggagagcggctggtggacc
gcgcccgagcggatcggtgaccgcgtcggccggctcgtcggcgccgcccccggccaggtg
gtcgtcggcgactcgacgagcgtgaacgtcttcaaggcggtcgtcgcggccgtacggatg
gctcaggagcgcggcgcccaccgcgatcagatcctggtcgacgaggccaccttccccacc
gacgggtatatcgccgagtccgccgcccggatgaccggctgcaccctgcggcctgtggcc
gcgggcgacatcccctccgctgtcggctctcggaccgccgtcgcgctcgtcaaccacgtg
gactaccgcaccggccgcctccatgacctgcccgggaccacggccgccgtgcacgcggcg
ggcgcgctcgtggtgtcggacctgtgccacagcgcgggcgccctgccggtcgggctggac
gcccacggcgtggacctcgcggtcggctgcacgtacaagtacctcaacggcgggcccggc
gcgcccgcgtatctgtacgtcgcgcgtgcgcatcagcccggcttcgactccccgctgccc
ggctggaactcgcatgccgaccccttcggcatggcctccgcctacaccccggccgacggt
gcggtccgcggccgcgtcggcaccccggacatcctctcgatgctggcgctggaggccgcg
ctcgaggtgtgggacgacgtgacgatcgaggacgtcagggccaagagcctggccctgacg
gacttcttcctccgctgcgtcgaggagtacgccccggcgggccgcgtccggtccctcacc
cccgccgcacacaccgagcgcggcagccaggtggcgctgcggtgcgcggacgcgggggag
gtgatggcggagctggtgcggcgcggtgtcgtgggcgacttccgccgccccgatgtgctg
cgcttcggcttcaccccgctgtacaccggcttcgccgaggtggagcgggcggcgcgggtg
ctggccgccgtgctgaaggagggctga

DBGET integrated database retrieval system