KEGG   Streptomyces malaysiensis: SMALA_4328Help
Entry
SMALA_4328        CDS       T05189                                 

Definition
(GenBank) glutamate-1-semialdehyde aminotransferase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
smal  Streptomyces malaysiensis
Pathway
smal00860  Porphyrin and chlorophyll metabolism
smal01100  Metabolic pathways
smal01110  Biosynthesis of secondary metabolites
smal01120  Microbial metabolism in diverse environments
Module
smal_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
smal_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:smal00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SMALA_4328
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:smal01007]
    SMALA_4328
Enzymes [BR:smal01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     SMALA_4328
Amino acid related enzymes [BR:smal01007]
 Aminotransferase (transaminase)
  Class III
   SMALA_4328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 CNP_C_terminal
Motif
Other DBs
NCBI-ProteinID: ATL84561
UniProt: A0A291SUS5
LinkDB All DBs
Position
5448982..5450205
Genome map
AA seq 407 aa AA seqDB search
MRAFRAVGGTPRFMVSGDGPYLTDADGREYVDLVCSWGPMILGHSHPEVIAAVQAAVARG
TSFGTPGEGEVELAEEIVARVAPVEQVRLVSSGTEATMSAIRLARGFTGRSKVIKFAGCY
HGHVDALLAAAGSGVATFGLPDTPGVTGAQAGETLVLPYNDLEAVRAAFVAHPGEIACVI
TEASPGNMGVVPPLPGFNAGLKQLCADHGALYISDEVMTGFRVSRAGWYGLDGVEPDLMT
FGKVMGGGFPAAAFGGRADVMGRLAPAGPVYQAGTLSGNPVATAAGIAQLRLLDDAAYAK
VDTASERLRAMVTEALAKEGVDHRVQVAGNMFSVFFTGDEVTDYEKAKAQEAFRFTAFFH
SMLSQGVYLPPSAFESWFVSTAHDERALERVAAALPGAARAAAEATE
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
gtgcgggcgttccgcgccgtgggaggtacgccccggttcatggtgtccggtgacggtccg
tacctcaccgacgccgatggacgcgagtatgtggacctcgtgtgctcgtggggtccgatg
atcctcggccactcccaccccgaggtcatcgcggccgtgcaggcggccgtcgctcgcggt
acgtcgttcggtacgccgggtgagggcgaggtcgagctcgccgaggagatcgtggcgcgg
gtcgccccggtcgagcaggtgcgcctggtctcgtccggcaccgaggcgacgatgtcggcg
atccggctggcccgcggcttcaccgggcggtccaaggtgatcaagttcgccggttgttat
cacgggcatgtggacgccctgctggccgcggccgggtccggcgtcgcgacgttcggactg
ccggacactccgggggtgacgggggcgcaggcgggggagaccctggtgctgccgtacaac
gacctggaggcggtccgggcggccttcgtcgcgcaccccggggagatcgcctgtgtgatc
accgaggcgtcgccgggcaacatgggcgtggtgccgccgctgcccgggttcaacgcgggc
ctcaagcagctctgcgccgaccatggcgcgctctacatctccgacgaggtcatgaccggc
ttccgggtctccagggccgggtggtacgggctggacggcgtggagccggacctgatgacc
ttcggcaaggtcatgggcggcggcttcccggccgcggccttcggcgggcgcgcggacgtc
atggggcgcctggccccggccggcccggtctaccaggcgggcacgctgtccgggaacccg
gtcgccacggccgcgggcatcgcgcagctgcggctgctggacgacgcggcgtacgccaag
gtcgacacggcctccgagcggctgcgggcgatggtgacggaggcgctcgccaaggagggc
gtggaccaccgggtccaggtcgcgggcaatatgttctcggtcttcttcaccggcgacgag
gtcaccgactacgagaaggccaaggcgcaggaggcgttccgcttcaccgccttcttccac
tcgatgctgtcgcagggggtctacctcccgccgtccgccttcgagtcgtggttcgtctcc
acggcgcatgacgagcgggcgctggagcgggtggcggcggctctgccgggggcggcgcgg
gccgccgccgaagccactgaatga

DBGET integrated database retrieval system