KEGG   Streptomyces malaysiensis: SMALA_4536Help
Entry
SMALA_4536        CDS       T05189                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
smal  Streptomyces malaysiensis
Pathway
smal00564  Glycerophospholipid metabolism
smal01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smal00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SMALA_4536
Enzymes [BR:smal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SMALA_4536
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 FAD_oxidored Pyr_redox_2 3HCDH_N GIDA
Motif
Other DBs
NCBI-ProteinID: ATL84766
UniProt: A0A291SV53
LinkDB All DBs
Position
5657064..5658719
Genome map
AA seq 551 aa AA seqDB search
MADRELDVLVVGGGVVGAGTALDAATRGLETGLVESRDWASGTSSRSSKLIHGGLRYLEM
LDFALVREALKERGLLLGRIAPHLVKPVPFLYPLQHRVWERFYAGSGVALYDAMSLSSGH
GRGLPGHRHLSRGRALLVAPCLKKDALVGALQYYDAQMDDARYVATLVRTAAKYGAQVTN
RARVVGFLREGERVVGARVHDLEQGGEFEVRARQVVNATGVWTDETQALIGERGQFHVRA
SKGIHLVVPKDRIHSTTGLILRTEKSVLFVIPWGRHWIIGTTDTDWDLDKAHPAASSADI
DYLLEHVNEVLAVPLTRDDVEGVYAGLRPLLAGESDATSKLSREHTVAHPVPGLVVVAGG
KYTTYRVMAKDAVDEAVHGLDRRVGPCVTEEIPLVGAVGYKALWNARERIGKQTGLHVAR
IEHLLNRYGSAAQEVLDLIADDPSLGKPLAGAEDYLRAEVSYAASHEGARHLDDVLTRRT
RISIETFDRGTRCAREVAGLMAPVLGWGDDQLDREVQHYEKRVEAERESQRQPDDLTADA
ARLGAPDIIPL
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggcggaccgtgagctcgatgtgctggtcgtgggcggcggagtggtcggcgcgggcacc
gcgctcgacgctgcgacacggggcctggagacgggcctggtcgagtcgcgggactgggcc
tccgggacctccagccggtccagcaagctgatccacggcggactgcgctatctggagatg
ctcgacttcgcactggtgcgcgaggcgctgaaggagcgcgggctgctgctggggcggatc
gcaccgcatctggtcaagccggtgccgttcctgtatccgctccagcaccgggtctgggag
cggttctacgccggatcgggcgtcgcgctctacgacgccatgtcgctctcctccgggcac
ggccgcggactgcccggccaccgccatctgagccgggggcgggcgctgctggtcgccccc
tgtctcaagaaggacgcgctggtcggggccttgcagtactacgacgcccagatggatgac
gcgcgctatgtcgccacgctcgtgcgcacggcggcgaaatacggcgcacaggtgaccaac
cgcgcgcgggtggtcggcttcctgcgggagggcgagcgcgtggtcggcgcccgggtgcac
gacctggagcagggcggcgagttcgaggtccgcgcccggcaggtggtcaacgccaccggg
gtgtggaccgatgagacgcaggcgctgatcggggagcgcgggcagttccacgtccgcgcc
tccaagggcatccacctggtcgtccccaaggaccgcatccactccacgaccgggctgatc
ctgcgcaccgagaagagcgtgctgttcgtgatcccctggggcaggcactggatcatcggc
accacggacaccgactgggacctggacaaggcccatccggccgcctccagcgccgatatc
gactatctgctggaacatgtcaacgaggtcctcgcggtgccgctcacccgcgacgacgtg
gagggcgtctacgccgggctgcgcccgctgctggccggggagtcggacgccaccagcaag
ctctcgcgcgagcacacggtcgcccatccggtgccgggcctggtggtggtcgcgggcggc
aagtacaccacgtaccgggtgatggccaaggacgccgtggacgaggcggtgcacggcctc
gaccgccgggtcgggccctgtgtcaccgaggagatcccgctggtcggcgccgtcggctac
aaggcgctgtggaacgcccgggagcgcatcggcaagcagaccgggctgcatgtggcgcgg
atcgagcatctgctcaaccgctacggctcggcggctcaggaggtgctggaccttatcgcg
gacgacccgtcgctggggaagccgctcgccggggcggaggactatctgcgcgccgaggtc
tcctacgccgcctcgcacgagggggcccgccatctggacgacgtcctcacccgccgcacc
cgcatctcgatcgagaccttcgaccgcggtacgcgctgcgcccgcgaggtggccgggctg
atggcgcccgtgctgggctggggcgatgaccagctcgaccgggaggtccagcactacgag
aagcgggtggaggccgagcgcgagtcccagcgccagccggacgatctgaccgcggacgcg
gcccggctgggcgcgcccgacatcatcccgctctag

DBGET integrated database retrieval system