KEGG   Streptomyces malaysiensis: SMALA_4606Help
Entry
SMALA_4606        CDS       T05189                                 

Definition
(GenBank) DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
smal  Streptomyces malaysiensis
Pathway
smal03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:smal00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    SMALA_4606
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:smal03400]
    SMALA_4606
Enzymes [BR:smal01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     SMALA_4606
DNA repair and recombination proteins [BR:smal03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     SMALA_4606
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ATL84836
UniProt: A0A291SVB9
LinkDB All DBs
Position
5756454..5757470
Genome map
AA seq 338 aa AA seqDB search
MSPITEVEGRRITLRNLDKVIHPATGTTKGELLHYLASTADALLGHLRGRPLAFLRYPDG
PDGQKFFTKNPPPGTPSWVTTAEVTRHKGETARQVLIQDLPSLMWAANLVVELHTPMWRI
DQGVGSADRLVLDLDPGPPATIVDCRVVAVWLRERLRADGLTAYAKTSGSKGLHLLVPLE
PTPSRQATAYARRLALEAANAMPDLVIRKMTRSLRPGKVYVDFSQNAAAKTTAAPYTPRA
LPEPAVSAPVTWEEVEECGDPSALTFLIDDIPARLDRHGDLLAPLLDPAQARPLPTGGGG
GDDGGDADEGEAADEGEADDEDAADDEDAADDEGAAER
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgtccccgatcacggaggtggaggggcggcggatcacgctcaggaacctcgacaaggtc
atccatccggccaccggcaccacgaagggcgagctgttgcactatctggcgtccaccgcg
gacgccctcctcggccatctgcgtgggcggccactggcgttcctgcgctacccggacggc
cccgacggccagaagttcttcaccaagaacccgcctccgggcacgccctcctgggtgacc
acggccgaagtcacccgccataagggggagaccgcgcggcaggtgctgatccaggacctg
ccctcgctgatgtgggcggccaacctcgtggtggagctccacactccgatgtggcggatc
gaccagggcgtgggcagcgccgaccggctcgtcctcgacctcgaccccgggccgcccgcc
acgatcgtggactgccgtgtcgtcgccgtatggctgcgggagcggctgcgcgccgacggc
cttacggcttacgccaagaccagtggctccaaggggctccatctgctggtgccgctggag
ccgaccccgtcccggcaggccaccgcctacgccagacggctggccctggaggccgcgaac
gccatgccggacctggtcatccgtaagatgacccgctcgctgcggccggggaaggtgtac
gtggacttcagccagaacgcggccgcgaagaccaccgccgccccgtacaccccgcgagcc
ctccccgaaccggccgtctccgcgccggtcacctgggaggaggtcgaggagtgcggcgac
ccctcggcgctgaccttcctgatcgacgacatccccgcgcggctcgaccgccacggggat
ctgctggccccgctgctggacccggcgcaggcacgcccgctgccgacgggcggcgggggc
ggggacgacggcggagacgccgacgagggcgaggccgccgatgagggcgaggcggacgat
gaagatgcggcggacgacgaagacgcggcggacgacgaaggcgcggcggagcgatga

DBGET integrated database retrieval system