KEGG   Streptomyces malaysiensis: SMALA_4745Help
Entry
SMALA_4745        CDS       T05189                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
smal  Streptomyces malaysiensis
Pathway
smal00620  Pyruvate metabolism
smal00680  Methane metabolism
smal01100  Metabolic pathways
smal01120  Microbial metabolism in diverse environments
smal01200  Carbon metabolism
Module
smal_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:smal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SMALA_4745
  09102 Energy metabolism
   00680 Methane metabolism
    SMALA_4745
Enzymes [BR:smal01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SMALA_4745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: ATL84975
UniProt: A0A291SVT0
LinkDB All DBs
Position
5902149..5904818
Genome map
AA seq 889 aa AA seqDB search
MGDLLGETLVRQEGPGLLELVERVRALTRSDGEAAAELLGSTDLQTAAKLVRAFSTYFHL
ANVTEQVHRGRELRARRAAEGGILARTADQLKDADPEHLRQTVANLGVRPVFTAHPTEAA
RRTVLTKLRRIAELLDTLAVSGDARRADLRLAENIDLLWQTDELRVARPEPADEARNAIY
YLDELHAGAVGDVLEDLSAELERVGVELPATTRPLTFGTWIGGDRDGNPNVTPEVTRDVL
ILQHEHGITDALEIIDDLRAALSSSIRNTGASEELLASLQRDLEQLPEISPRYKRLNAEE
PYRLKATCMRQKLVNTRERLAGDTPHQPGRDYLGSGELLADLHLIQDSLRAHRGQLIAGG
RLERSIRTLAAFGLQLATMDVREHADAHHHALGQLFDRLGEESWRYADMPRDYRRKLLAK
ELRSRRPLAPTPAPLDAAGAKTLGVFHTIRESFERFGPEIVESYIISMCQGSDDVFAAAV
LAREAGLIDLHAGWAKIGIVPLLETTEELKIADKLLDEMLADPSYRRLVALRGDVQEVML
GYSDSSKFGGITTSQWEIHRAQRLLRDVAHRHGVRLRLFHGRGGTVGRGGGPTHDAILAQ
PWGTLEGEIKVTEQGEVISDKYLVPSLARENLELTVAATLQASALHTAPRQSVEALARWD
AAMETVSEAAHGAYRALVDDPDLPAYFFASTPVDQLAELHLGSRPSRRPDSGAGLDGLRA
IPWVFGWTQSRQIVPGWFGVGSGLKAAREAGLDGVLDEMHQHWHFFRNFLSNVGMTLAKT
DLRIAQHYVDTLVPDELKHVFEVIQEEHELTVREVLRITGERELLDSNPVLKQTFHVRDA
YLDPISYLQVTLLHRQRTARERGEEPDPLLGRALLLTVNGVAAGLRNTG
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
ttgggtgacctgctcggcgagaccctcgtccgccaggagggacccggcctcctcgaactg
gtcgagcgcgtccgtgccctcacccgcagtgacggcgaggccgccgccgaactgctcggc
tccaccgacctccagaccgccgccaagctggtccgcgccttctccacctacttccacctg
gcgaacgtcaccgaacaggtgcaccgcggccgcgagctgcgcgcccgccgcgccgccgag
ggcggcatcctcgcccgcaccgccgaccagctcaaggacgccgatcccgagcacctccgg
cagaccgtggccaacctgggcgtacgtcccgtcttcaccgcccaccccaccgaggccgcc
cgccgcacggtcctcaccaagctgcgccgcatcgccgaactgctcgacaccctcgccgtc
agcggcgacgcccgccgcgccgatctgcggctcgccgagaacatcgacctgctctggcag
acggacgagctgcgggtcgcccgtcccgaacccgccgacgaggcgcgcaacgccatctac
tacctggacgagctgcacgcgggcgccgtcggcgatgtgctggaggacctcagcgccgag
ctcgagcgcgtcggcgtcgaactgcccgccaccacccgccccctcaccttcggcacctgg
atcggcggcgaccgcgacggcaaccccaatgtcacccccgaggtgacccgcgacgtgctg
atcctccagcatgagcacggcatcaccgacgcgctggagatcatcgacgatctgcgcgcc
gcgctctccagctccatccgcaacaccggcgcctcggaggaactcctcgcctccctccag
cgcgacctcgaacagctgccggagatcagcccgcgctacaagcggctcaacgccgaggag
ccctaccggctcaaggccacctgcatgcggcagaagctcgtcaacacccgtgagcggctc
gccggggacaccccgcaccagcccggccgcgactacctcggctccggcgaactcctcgcc
gacctccacctcatccaggactccctgcgcgcccaccgcggtcagctcatcgccggcggc
cggctcgaacgctccatccgcaccctcgccgccttcggcctccagctcgccacgatggac
gtccgcgaacacgccgacgcccaccaccacgccctcggccagctcttcgaccggctcggc
gaggaatcctggcgctacgccgacatgccgcgcgactaccgccgcaagctgctcgccaag
gagctgcgctctcggcgccccctcgcccccaccccggcgcccctcgacgccgccggtgcc
aagaccctcggcgtcttccacaccatccgcgaatccttcgagcgcttcggccccgagatc
gtggagtcctacatcatctccatgtgccagggctccgacgatgtcttcgccgccgccgtc
ctcgcccgcgaggccgggctgatcgacctccacgcgggctgggccaagatcggcatcgtt
ccgctgctggagaccaccgaagagctcaagatcgccgacaagctcctcgacgagatgctc
gccgacccctcctaccggcggctcgtcgccctccgcggcgatgtccaggaggtcatgctc
ggctactccgactcgtccaagttcggcggcatcaccacctcccagtgggagatccaccgc
gcccagcggctgctgcgcgatgtcgcccaccggcacggcgtacggctgcggctcttccac
ggccgcggcggcaccgtcggccgcggcggcggccccacccacgacgcgatcctcgcccag
ccgtggggcaccctcgaaggcgagatcaaggtcaccgagcagggcgaggtcatctccgac
aagtacctcgtgccctcgctcgcccgcgagaacctggagctcacggtcgccgccacgctc
caggcgtccgccctgcacaccgcgccccgccagtccgtcgaggcgctcgcccgctgggac
gcggccatggagacggtctccgaggccgcccacggcgcctaccgcgcgctcgtggacgac
cccgacctgcccgcgtacttcttcgcctccaccccggtcgaccagctcgccgagctccac
ctgggctcccggccctcccgccgccccgactccggcgccggcctcgacgggctacgggcc
atcccgtgggtgttcggctggacccagtcccggcagatcgtccccggctggttcggcgtc
ggctccggcctcaaggccgcccgcgaggccgggctcgacggcgtcctggacgagatgcac
cagcactggcacttcttccgcaacttcctctccaacgtcgggatgacgctggccaagacg
gacctgcggatcgcccagcactacgtggacacgctggtccccgacgagctgaagcacgtc
ttcgaggtgatccaggaggagcacgagctgacggtgcgggaagtgctgcgcatcaccggt
gagcgggagctcctcgactccaacccggtgctgaagcagaccttccacgtccgggacgcc
tacctcgacccgatctcgtacctccaggtgaccctgctgcaccgccagcgcaccgcgcgc
gaacggggcgaggagcccgacccgctgctcggccgcgcgctcctcctcacggtcaacggc
gtcgcggcgggcctccgcaacacgggttga

DBGET integrated database retrieval system