KEGG   Streptomyces malaysiensis: SMALA_5225Help
Entry
SMALA_5225        CDS       T05189                                 

Definition
(GenBank) putative nickel superoxide dismutase
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
smal  Streptomyces malaysiensis
Brite
KEGG Orthology (KO) [BR:smal00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SMALA_5225
Enzymes [BR:smal01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SMALA_5225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni BtrH_N
Motif
Other DBs
NCBI-ProteinID: ATL85455
UniProt: A0A291SX60
LinkDB All DBs
Position
complement(6431003..6431398)
Genome map
AA seq 131 aa AA seqDB search
MLSRLFAPKVQVSAHCDLPCGVYDPAQARIEAESVKAIQEKYQANEDPHFRARATTIKEE
RAELAKHHISVLWSDYFKPPHFEKYPELHQLVNDTLKALSAAKGSTDPATGQKALDYIAQ
VDKIFWETKKG
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgctctcccgcctgttcgcccccaaggttcaggtcagcgcccactgcgatctgccctgc
ggcgtgtacgacccggcccaggcccgtatcgaagccgagtccgtcaaggccatccaggag
aagtaccaggccaacgaggacccgcacttccgcgcccgggccaccaccatcaaggaggag
cgcgcggagctcgccaagcaccacatctcggtgctgtggagcgactacttcaagcccccg
cacttcgagaagtaccccgagctgcaccagctggtcaacgacaccctcaaggccctgagc
gcggccaagggctcgaccgacccggccacggggcagaaggctctggactacatcgcccag
gtcgacaagatcttctgggagaccaagaagggctga

DBGET integrated database retrieval system