KEGG   Streptomyces malaysiensis: SMALA_5606Help
Entry
SMALA_5606        CDS       T05189                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase, PLP-dependent
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
smal  Streptomyces malaysiensis
Pathway
smal00250  Alanine, aspartate and glutamate metabolism
smal00280  Valine, leucine and isoleucine degradation
smal00310  Lysine degradation
smal00410  beta-Alanine metabolism
smal00640  Propanoate metabolism
smal00650  Butanoate metabolism
smal01100  Metabolic pathways
smal01120  Microbial metabolism in diverse environments
Module
smal_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:smal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SMALA_5606
   00650 Butanoate metabolism
    SMALA_5606
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SMALA_5606
   00280 Valine, leucine and isoleucine degradation
    SMALA_5606
   00310 Lysine degradation
    SMALA_5606
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SMALA_5606
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:smal01007]
    SMALA_5606
Enzymes [BR:smal01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SMALA_5606
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     SMALA_5606
    2.6.1.48  5-aminovalerate transaminase
     SMALA_5606
Amino acid related enzymes [BR:smal01007]
 Aminotransferase (transaminase)
  Class III
   SMALA_5606
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Ligase_CoA
Motif
Other DBs
NCBI-ProteinID: ATL85836
UniProt: A0A291SY65
LinkDB All DBs
Position
complement(6877490..6878839)
Genome map
AA seq 449 aa AA seqDB search
MTELSGGPSLPQERRVVTAIPGPKSQELLARKNAAVAGGVGSVLPVFTVRAGGGVIEDVD
GNSLIDFGSGIAVTSVGSSAEAVVRRASAQLADFTHTCFMVTPYEGYVEVCEELARLTPG
DHAKKSALFNSGAEAVENAVKIARSYTKRQAVVVFDHGYHGRTNLTMALTAKNMPYKHGF
GPFAPEVYRVPLAYPYRWLTGPENCAEEAAAQAIDMISKQVGAENVAAIIIEPVLGEGGF
IEPAKGFLPRIAEFARANGIVFVADEIQSGFCRTGQWFACEDEGIVPDLITTAKGIAGGL
PLAAVTGRAEIMDAAHSGGLGGTYGGNPVACAAALGAIETMRELDLNAKAKRIEEVMKGR
LGAMREKYDIIGDLRGRGAMIAIELVKPGTKDPSPEATAAVAKACHSAGLLVLTCGTYGN
VLRFLPPLVIGEDLLNEGLDILESAFAEL
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaattgtccggaggcccgtccctcccccaggagcgtcgcgtcgtcaccgccatt
cccggcccgaagtcgcaggaactgctcgcccgtaagaacgccgcggtcgccggcggggtg
gggagtgtgctgccggtcttcaccgtgcgcgcgggtggcggtgtgatcgaggacgtggac
ggcaactcgctgatcgacttcggttccggtatcgccgtgacctccgtcggctcctccgcg
gaggccgtcgtgcgccgggcgtccgcacagctggcggacttcacgcacacctgtttcatg
gtcacgccgtacgagggctatgtggaggtctgtgaggagctggcgcggctcacgcccggc
gaccacgccaagaagtcggcgctgttcaactcgggcgccgaggcggtggagaacgcggtg
aagatcgcccgttcgtacaccaagcgccaggcggtcgtcgtcttcgaccacggctaccac
ggccggaccaacctcaccatggcactcaccgccaagaacatgccgtacaagcacggcttc
ggccccttcgcgcccgaggtctaccgcgttccgctcgcctacccctaccgctggctgacc
ggcccggagaactgcgccgaggaggccgcggcccaggccatcgacatgatcagcaagcag
gtcggggcggagaacgtggccgcgatcatcatcgagccggtgctcggcgagggcggcttc
atcgagcccgccaagggcttcctgcccaggatcgcggagttcgccagggccaatggcatc
gtcttcgtcgcggacgagatccagtccggattctgccgcaccggtcagtggttcgcctgt
gaggacgagggcatcgtcccggacctgatcaccaccgccaagggcatcgcgggcggtctg
ccgctcgccgccgtcaccggccgcgcggagatcatggacgcggcgcactccggcggtctc
ggcggcacctacggcggcaacccggtggcgtgcgccgcggcgctcggcgcgatcgagacg
atgcgcgagctggacctcaacgccaaggccaagcgcatcgaggaggtcatgaagggccgc
ctcggcgcgatgcgggagaagtacgacatcatcggcgacctccgcggccgcggcgccatg
atcgccatcgaactggtgaagcccggtaccaaggaccccagccccgaggccacggccgcc
gtcgccaaggcgtgccactcggccgggctgctggtgctgacctgcggaacctacggcaat
gtgctgcgattcctgccgccgctggtgatcggcgaggacctcctgaacgagggtctcgac
atcctcgaaagcgccttcgccgagctgtga

DBGET integrated database retrieval system