KEGG   Streptomyces malaysiensis: SMALA_6074Help
Entry
SMALA_6074        CDS       T05189                                 

Definition
(GenBank) aminotransferase class III
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
smal  Streptomyces malaysiensis
Pathway
smal00250  Alanine, aspartate and glutamate metabolism
smal00410  beta-Alanine metabolism
smal00640  Propanoate metabolism
smal00650  Butanoate metabolism
smal01100  Metabolic pathways
smal01120  Microbial metabolism in diverse environments
Module
smal_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:smal00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SMALA_6074
   00650 Butanoate metabolism
    SMALA_6074
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SMALA_6074
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SMALA_6074
Enzymes [BR:smal01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SMALA_6074
Amino acid related enzymes [BR:smal01007]
 Aminotransferase (transaminase)
  Class III
   SMALA_6074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ATL86302
UniProt: A0A291SZJ1
LinkDB All DBs
Position
7484983..7486359
Genome map
AA seq 458 aa AA seqDB search
MNDGNDVKDGNGAKNTKRDLSRGPHATLHARHQAVLPDWLAVYYQRPIEITHGEGRHVWD
AEGNRYLDFFGGILTTMTAHALPEVTKAISEQAGRILHTSTLYLDRPMVELAERVAALSG
IPDARVFFTTSGTEANDTALLLATTHRRSNQILAMRNSYHGRSFSAVGITGNRGWSPTSL
SPLQTLYVHGAVRTRGPFAGLSDGEFIKACVADLEDILGQAHGNVAALIAEPIQGVGGFT
SPPDGLFAAFREVLDRHGILWITDEVQTGWGRTGDHFWGWQAHDGSGPPDILTFAKGIGN
GMSIGGVVARAEVMNCLDANSISTFGGSPITMAAGLANLNHLVEHDLQGNARRVGGLLIE
RLRAACAGLDTVREVRGRGLMIGVELVEPGTGEPSPEGASAVLEAAREGGLLIGKGGGHN
SSVLRIAPPLSLTVAEAEEGAEILEAALGTARSGRSAS
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgacggcaatgacgtaaaggacggcaacggcgcaaaaaacaccaagcgcgacctg
agccgcgggccccacgccaccctccacgcacggcaccaagccgtcctccccgactggctc
gccgtctactaccagcgccccatcgagatcacccacggcgagggccgccatgtctgggac
gccgagggcaaccgctacctcgacttcttcggcggcatcctcaccacgatgaccgcacac
gccctccccgaggtgaccaaggcgatcagcgagcaggcgggccggatcctgcacacctcc
acgctctacctcgaccggcccatggtcgagctggccgagcgggtcgcagcgctgtccggc
atcccggacgcgcgggtcttcttcaccacctccggcaccgaggccaatgacacggccctg
ctgctcgccaccacccaccgccgttccaaccagatcctggcgatgcgcaacagctaccac
ggccgctccttctcggccgtcggcatcacgggcaaccgcggctggtcgccgaccagcctg
tcgccgctccagacgctgtacgtacatggcgcggtgcgcacccggggcccgttcgccggg
ctgtcggacggggagttcatcaaggcgtgcgtggccgatctggaggacatcctcgggcag
gcgcacggcaatgtcgccgcgctgatcgccgagccgatccagggcgtcggcggcttcacc
tcgccgcccgacgggctgttcgccgccttccgcgaggtgcttgaccggcacggcatcctg
tggatcaccgatgaggtgcagaccggctggggccgcaccggtgatcacttctggggctgg
caggcgcacgacggctccgggccgcccgacatcctcaccttcgccaagggcatcggcaac
ggcatgtcgatcggcggtgtcgtcgcccgcgccgaggtcatgaactgcctggacgccaac
tccatctccaccttcggcggcagccccatcacgatggccgccgggctggccaacctcaac
cacctggtcgaacacgacctccagggcaacgcccgccgggtcggcgggctgctgatcgag
cggctgcgcgccgcctgcgccggtctggacaccgtgcgcgaggtccgcggccgggggctg
atgatcggcgtcgagctggtggagccgggcaccggcgagccgtcccccgagggcgcgtcc
gccgtgctggaggcggcccgggagggcgggctgctcatcggcaagggcggtgggcacaac
agcagcgtgctgcggatcgccccgccgctcagcctcaccgtcgccgaggccgaggagggt
gcggagatcctcgaggccgccctggggaccgcccggtccggaaggagcgcgagctga

DBGET integrated database retrieval system