KEGG   Streptomyces malaysiensis: SMALA_6179Help
Entry
SMALA_6179        CDS       T05189                                 

Definition
(GenBank) neuraminidase
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
smal  Streptomyces malaysiensis
Pathway
smal00511  Other glycan degradation
smal00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:smal00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    SMALA_6179
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SMALA_6179
Enzymes [BR:smal01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     SMALA_6179
Bacterial toxins [BR:smal02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   SMALA_6179
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 Laminin_G_3 BNR_3 Laminin_G_2 BNR Laminin_G_1 DUF4185
Motif
Other DBs
NCBI-ProteinID: ATL86407
UniProt: A0A291SZX6
LinkDB All DBs
Position
complement(7604155..7605981)
Genome map
AA seq 608 aa AA seqDB search
MSAARADSGFEQQVLFKSAQELGYSCFRIPAVVKAKDGTLLAFAEGRVDNCGDAGDIDLV
LKRSTDGGRTWGPLQVINEGEGDTHGNPAPVVDMRTGRIVLASTYNTGRDDSQSCDVPCD
RSPHLQYSDDNGATWSAPRDMSSSLMPPDWNSWYATGPVHGIQLQRGRHKGRLVFTLNTE
SFSGGRITHNHAALAYSDDGGNRWRIGAVDTYPLAEDGTFRQKPSEMTLVERADGSIYVS
GREQDGTDLGHRDYAISRDGGRSFTGPFRTIPDLPTPQVQGSILRLRDPARDGHGRLLFS
APADPDRRRTMMVRSSWDEARTWDGVERGKVVTTDWSGYSDMVAISPDTVGLLYEGGAVD
ARDEIRFARFTEDWLGSRRPPAPITDDRASGARSATVLGGAAPRADGRFDGALSFDGTDD
AVRVPYRNALPLGTRDFTVSLWFRYSAASGQHPFLWMGGIGNKQPQVWLRGEPGSNRIRA
LMTTVNGFATFTNASVSTDAAYNDGQWHHLALVRGGGRLSLTVDGGTAVTAPDAPGTVSR
TAPFGLHLGQAVDSRSHMTGDLDEFRLYARALTDTELRRVREFNAPLDGSHSGPLVRLPL
DRVRSSHP
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgcggcccgtgccgactccggcttcgaacaacaggtcctcttcaagtccgcccag
gaactgggctactcctgcttccggattccggcggtcgtcaaggccaaggacggcaccctg
ctcgccttcgccgagggccgggtcgacaactgcggcgacgccggggacatcgatctggtg
ctcaagcgctccaccgacggcggccgcacctggggcccgctccaggtgatcaacgagggc
gagggggacacccacggcaaccccgcgcccgtcgtggacatgcgcaccggccgcatcgtg
ctcgccagcacgtacaacaccggccgcgacgactcccagagctgtgacgtcccctgtgac
cgcagcccgcacctccagtacagcgacgacaacggcgccacctggtcggccccgcgcgat
atgagctcctcgctgatgccgccggactggaactcctggtacgccaccggccccgtccac
ggcatccagctccagcgcggccggcacaagggccggctggtcttcaccctcaacaccgag
agcttcagcggcggccgcatcacccacaaccacgccgcgctcgcctacagcgacgacggc
ggcaaccgctggcgcatcggcgcggtggacacctacccgctcgccgaggacggcaccttc
cgccagaagccgtccgagatgacgctggtggagcgcgccgacggatcgatctacgtcagc
ggacgggagcaggacggcaccgatctgggccaccgcgactacgccatcagccgggacggc
ggccggagcttcaccgggccgttccgcaccatccccgatctgcccaccccccaggtgcag
gggtcgatcctgcggctgcgcgacccagcccgcgacggccacggccggctgctcttctcc
gcccccgccgaccccgaccgccgccgcaccatgatggtccgctcctcctgggacgaggcc
cgcacctgggacggtgtcgagcgcggcaaggtcgtcaccaccgactggtccggctactcc
gacatggtggcgatctcacccgacacggtggggctgctgtatgagggcggtgcggtggac
gcccgtgacgagatccgcttcgcccgcttcaccgaggactggctgggctcccgccggccg
cccgcccccatcaccgacgaccgcgcgtccggcgcccggtccgcgaccgtgctcggcggt
gcggcgccacgcgccgacggccgcttcgacggggcgctgtccttcgacggcacggacgac
gcggtacgcgtcccataccggaacgcgctgccgctgggcacccgcgacttcaccgtgagc
ctgtggttccgctactcggccgcctccgggcagcatccgttcctctggatgggcggcatc
ggcaacaaacagccgcaggtctggctgcgcggtgagcccgggagcaaccggatccgggcg
ctgatgaccacggtcaacggcttcgccaccttcaccaacgcctcggtgtccaccgacgcc
gcgtacaacgacgggcagtggcaccacctcgccctggtccgcggcggcggccggctctcc
ctcaccgtggacggcggcaccgccgtcaccgcccccgacgccccgggcaccgtgagccgc
accgcgcccttcggcctccacctcggccaggccgtggacagccgctcccatatgacgggc
gatctcgatgagttccgtctgtacgcccgtgccctgaccgacaccgagctgcggcgcgtc
cgcgagttcaacgccccgctcgacggctcccactccggccccctcgtccgcctccccctg
gaccgcgtgcggtcatcccacccctaa

DBGET integrated database retrieval system