KEGG   Streptomyces malaysiensis: SMALA_6412Help
Entry
SMALA_6412        CDS       T05189                                 

Definition
(GenBank) acetylornithine aminotransferase
  KO
K00821  acetylornithine/N-succinyldiaminopimelate aminotransferase [EC:2.6.1.11 2.6.1.17]
Organism
smal  Streptomyces malaysiensis
Pathway
smal00220  Arginine biosynthesis
smal00300  Lysine biosynthesis
smal01100  Metabolic pathways
smal01110  Biosynthesis of secondary metabolites
smal01120  Microbial metabolism in diverse environments
smal01210  2-Oxocarboxylic acid metabolism
smal01230  Biosynthesis of amino acids
Module
smal_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
smal_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:smal00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    SMALA_6412
   00220 Arginine biosynthesis
    SMALA_6412
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:smal01007]
    SMALA_6412
Enzymes [BR:smal01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.11  acetylornithine transaminase
     SMALA_6412
    2.6.1.17  succinyldiaminopimelate transaminase
     SMALA_6412
Amino acid related enzymes [BR:smal01007]
 Aminotransferase (transaminase)
  Class III
   SMALA_6412
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ATL86640
UniProt: A0A291T0M2
LinkDB All DBs
Position
7876860..7878020
Genome map
AA seq 386 aa AA seqDB search
MDNYGTPRIPLTHGEGTKVWDADGKEYLDFVGGIAVNSLGHAHPAVVRAVSQQVATLGHV
SNLFVAEPPVALAERLLQLFGRSGRVYFSNSGAEAVEAAFKIGRRTGRTHMVATTGGFHG
RTMGALALTGQPGKQEPFRPLPGDVTHVPYGDVAALRAAVTTDTTFVIVEPIQGENGVVV
PPAGYLAAAREITRATGTLLVLDEIQTGIGRTGHWFEHQAQGVEPDVVTLAKGLGAGLPI
GATIAFGPAAELLTPGQHGSTFGGNPVACAAALAVLDTIAADGILDRVKRAGERLRNGIE
SLDHAAVARVRGAGLLLGIVLTESLAPQVQKAAQDAGLLVNAVAPDVVRLAPPLVITDEE
VETFLRELPAVLDAAYEGDGERRAGD
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggacaactacggcaccccccgcatcccgctcacccacggcgagggcaccaaggtctgg
gacgcggacggcaaggagtacctcgacttcgtcggcggtatcgcggtgaactccctcggc
catgcccaccccgccgtcgtgcgggccgtctcccagcaggtcgccacgctcggccatgtc
tccaacctctttgtcgccgagcccccggtggcgctcgccgagcggctgctccagctcttc
ggccgctccgggcgcgtgtacttctccaactccggcgcggaggcggtcgaggccgccttc
aagatcgggcggcgcaccgggcgcacccatatggtggccaccaccggcggcttccacggc
cgcaccatgggcgcgctggcgctgaccggccagcccggcaagcaggagcccttccgtccg
ctgcccggcgatgtgacccatgtgccgtacggggacgtggcggcgctgcgcgcggccgtc
accaccgacaccaccttcgtgatcgtggagcccatccagggcgagaacggcgtggtcgtg
ccgccggccggctatctcgcggcggcgcgggagatcacccgggccaccggcaccctgctg
gtgctcgacgagatccagaccgggatcgggcggaccggccactggttcgagcaccaggcg
cagggcgtcgagcccgatgtcgtcaccctcgccaaggggctcggcgccgggctgcccatc
ggcgccaccatcgccttcggacccgcggccgagctgctgacccccggtcagcacggttcc
accttcggcggaaaccccgtcgcctgcgccgccgctctcgccgtcctggacacgatcgcc
gccgacggcatcctggaccgggtcaagcgggcgggggagcggctgcgtaacggaatcgaa
tcgctcgaccacgcagcggtcgcccgggtccgcggcgccgggctgctgctcggtatcgtg
ctcacagagtccctcgcgccgcaggtgcagaaggcggctcaggacgcgggactcctggtg
aacgcggtcgcgccggatgtggtccggctcgccccgccgctcgtcatcaccgacgaggag
gtggagaccttcctccgggagctgcccgcggtcctggacgccgcatacgagggtgacggg
gaacgacgagccggagactga

DBGET integrated database retrieval system