KEGG   Streptomyces malaysiensis: SMALA_6525Help
Entry
SMALA_6525        CDS       T05189                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
smal  Streptomyces malaysiensis
Pathway
smal00400  Phenylalanine, tyrosine and tryptophan biosynthesis
smal01100  Metabolic pathways
smal01110  Biosynthesis of secondary metabolites
smal01130  Biosynthesis of antibiotics
smal01230  Biosynthesis of amino acids
Module
smal_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:smal00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SMALA_6525
Enzymes [BR:smal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     SMALA_6525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA Cytidylate_kin2 Fe-ADH RuvB_N
Motif
Other DBs
NCBI-ProteinID: ATL86753
UniProt: A0A291T0U0
LinkDB All DBs
Position
7996716..7997198
Genome map
AA seq 160 aa AA seqDB search
MGVGKTTVGQVLAERLGTTFRDTDTDIVTAAGKEISEIFIDEGEPHFRELERQAVRTAVA
EHPGVLALGGGAVLDEDTRALLSGRPVVFLEMGVAAAVKRTGLDAPRPLLAVNPRQRWRE
LMEQRRPLYTEVARAVVSTEDRTPDDVADAVLDVLELKNA
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgggggttgggaagaccaccgtcgggcaggtgctcgcggagcggctcggcaccaccttc
cgcgacaccgacaccgacatcgtcacggccgccggcaaggagatctcggagatcttcatc
gacgagggcgagccgcacttccgcgagctggagcggcaggccgtacggaccgccgtcgcc
gagcaccctggcgtgctcgcgctgggcggcggcgccgttctggacgaggacacccgggcg
ctgctcagcggccgtcccgtcgtcttcctggagatgggcgtcgccgcggccgtcaagcgc
accgggcttgacgccccgcgcccgctgctcgcggtcaatccgcgccagcgctggcgtgag
ctgatggagcagcgccgcccgctgtacaccgaggtcgcccgcgccgtggtgtcgaccgag
gaccgcacccccgacgacgtggccgatgccgtcctggacgtactggagctgaagaacgca
tga

DBGET integrated database retrieval system