KEGG   Streptomyces malaysiensis: SMALA_6915Help
Entry
SMALA_6915        CDS       T05189                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
smal  Streptomyces malaysiensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: ATL87135
UniProt: A0A291T1Y8
LinkDB All DBs
Position
8487719..8488792
Genome map
AA seq 357 aa AA seqDB search
MDLPVMPPVQPMLAKAVATIPPGMVYEGKWDGFRAIVFRDGDEIEISSRTTKPLTRYFPE
LAEALLANLPPRCVLDGEIVIVRGGRLDFDALLERIHPADSRVRLLAKTTPAAFVAFDIL
ALGDASLMATPLSERREALTEALRGAADPVHLAPCTDELEVARQWFEQYEGAGLDGVVAK
SPDLRYLPGERVMVKVKHERTADCVVAGYRVHKSGQGIGSLLLGLYDATGRLQHVGVSAA
FSARRRQELMAELEPLRMETVEGHPWADWAREEAHARGRMPGAPSRWTGVKDLSWVPLRP
ERVCEVAYDHMQSGRFRHTARFRRWRPDREPPQCTYDQLEEPVSYDLGQVLGSAPEP
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggaccttccggtgatgcctcccgtccagccgatgctggccaaggccgtggccacgatc
ccgcccggaatggtctacgagggcaaatgggacggcttccgggccatcgtcttccgcgac
ggggacgagatcgagatcagcagccgtaccaccaagccgctcacccgctacttccccgaa
ctggccgaggcgctgctcgccaacctcccgccgcgctgcgtcctggacggcgagatcgtc
atcgtgcgcggcgggcggctcgacttcgacgccctcctggagcggatccaccccgccgac
tcccgggtgcggctgctggcgaagaccaccccggccgccttcgtggccttcgacatcctc
gccctcggcgacgcctcgctgatggccaccccgctgagcgagcgccgcgaggcgctgacc
gaggcgctgcgcggcgccgcggacccggtgcacctcgccccctgcaccgacgagctcgag
gtggcccggcagtggttcgagcagtacgagggggcggggctcgacggcgtcgtggccaag
agccccgacctccgctacctccccggagagcgcgtgatggtcaaggtcaagcacgagcgc
accgccgactgtgtggtggccggctaccgcgtccacaaatcagggcagggcatcggctcc
ctgctgctgggcctgtacgacgccaccggccgcctccagcacgtgggcgtcagcgcggcc
ttctccgcgcgccgccgccaggagctgatggccgagctggaaccgctgcgcatggagacc
gtcgaaggccacccctgggccgactgggcgcgcgaggaggcccatgcccggggccggatg
ccgggcgcgcccagccgctggaccggggtcaaggacctgtcgtgggtgccgctgcgcccc
gagcgggtgtgcgaggtggcctacgaccatatgcagagcggccgcttccggcacaccgcc
cgcttccgccgctggcggccggaccgggagcccccgcagtgcacctacgaccagctggag
gagccggtctcctacgatctgggccaggtgctggggtccgcgccggagccgtag

DBGET integrated database retrieval system