KEGG   Streptomyces malaysiensis: SMALA_7092Help
Entry
SMALA_7092        CDS       T05189                                 

Definition
(GenBank) methylmalonyl-CoA mutase large subunit
  KO
K01847  methylmalonyl-CoA mutase [EC:5.4.99.2]
Organism
smal  Streptomyces malaysiensis
Pathway
smal00280  Valine, leucine and isoleucine degradation
smal00630  Glyoxylate and dicarboxylate metabolism
smal00640  Propanoate metabolism
smal01100  Metabolic pathways
smal01120  Microbial metabolism in diverse environments
smal01200  Carbon metabolism
Module
smal_M00741  Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA
Brite
KEGG Orthology (KO) [BR:smal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SMALA_7092
   00640 Propanoate metabolism
    SMALA_7092
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SMALA_7092
Enzymes [BR:smal01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.2  methylmalonyl-CoA mutase
     SMALA_7092
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MM_CoA_mutase B12-binding
Motif
Other DBs
NCBI-ProteinID: ATL87312
UniProt: A0A291T2E9
LinkDB All DBs
Position
8690790..8693003
Genome map
AA seq 737 aa AA seqDB search
MEPGKIPDFSAVDLDGPAEGPVPSSDDWAAALQNSVGKGVEDLVWDTPEGIGVKPLYTAE
DLTGVDFLGTYPGAAPYLRGPYPTMYVNQSWTIRQYAGFSTAEESNAFYRRNLAAGQKGL
SVAFDLPTHRGYDSDHLRVTGDVGMAGVAIDSIYDMRQLFDGIPLDRMSVSMTMNGAVLP
VLALYIVAAEEQGVPPEKLAGTIQNDILKEFMVRNTYIYPPQPSMRIISDIFAFTSQRMP
RYNSISISGYHIQEAGATADLELAYTLADGVEYLRAGRDAGMDVDAFAPRLSFFWAIGMN
FFMEIAKLRAARLLWAKLVKQFDPKNPKSLSLRTHSQTSGWSLTAQDVYNNVARTCVEAM
AATQGHTQSLHTNALDEALALPTDFSARIARNTQILLQQESGTTRVIDPWGGSAYVEKLT
YDLARRAWQHIEEVEAAGGMAKAIDAGIPKLRVEEAAARTQARIDSGRQPVIGVNKYRVD
SDEAIEVRAVDNTVVRAQQIEKLRRLRAERDEAACQGALRALTAAAESGPGAGLEGNLLA
LAVDAARAKATVGEISDALEKVYGRHSGQIRTISGVYREEAGPSSGVDRTRTLVEAFERE
EGRRPRILVAKMGQDGHDRGQKVIATAFADLGFDVDVGPLFQTPEEVARQAVEADVHIVG
VSSLAAGHLTLVPALREQLAEAGREDITIVVGGVIPPQDVQTLHEAGAAAVFLPGTVIPD
AAHDLVRKLAADLGHEL
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
gtggagcccgggaagatcccggacttctcggcggtcgatctggacggaccggccgaaggt
ccggtgcccagctcggacgactgggccgccgccttgcagaacagcgtgggcaagggcgtg
gaggacctggtgtgggacacccccgagggcatcggggtcaagccgctctacaccgccgag
gacctcacgggcgtcgacttcctgggcacctaccccggcgccgcgccgtatctgcgcggc
ccgtacccgacgatgtacgtcaaccagtcctggaccatccggcagtacgcggggttctcc
accgccgaggagtccaacgccttctaccgccgcaatctcgcggccggtcagaagggcctg
tcggtcgccttcgacctgcccacccaccggggctatgacagcgaccatctccgggtcacc
ggtgacgtcggcatggcgggcgtggccatcgactccatctacgacatgcggcagctcttc
gacggcatcccgctggaccggatgagcgtgtcgatgacgatgaacggcgcggtgctgccc
gtgctcgcgctctacatcgtggccgccgaggagcagggcgtaccgcccgagaagctggcc
gggaccattcagaacgacatcctcaaggagttcatggtccgcaacacctatatctatccg
ccgcagccgtcgatgcggatcatctccgacatcttcgccttcacctcgcagcggatgccg
cgctacaactccatctccatctcgggctaccacatccaggaggccggggccacggccgat
ctggagctggcgtacaccctcgccgacggtgtggagtacctgcgggccggccgggacgcc
gggatggacgtggacgccttcgcgccccggctgtcgttcttctgggcgatcggcatgaac
ttcttcatggagatcgccaagctgcgggcggcccggctgctgtgggccaagctggtcaag
cagttcgacccgaagaaccccaagtcgctttcgctgcgcacccattcgcagacctccggc
tggtcgctcaccgcccaggacgtctacaacaacgtggcgcgcacctgtgtggaggccatg
gccgccactcagggccacacccagtcgctgcacaccaacgcgctggacgaggcgctcgcg
ctgcccaccgacttctccgcgcggatcgcccgcaacacccagatcctgctccagcaggag
tcgggcaccacccgggtcatcgacccgtggggcggcagtgcctacgtcgagaagctgacg
tacgacctggcgcggcgggcctggcagcacatcgaggaggtcgaggctgccggtggtatg
gccaaggccatcgacgcgggcatccccaaactgcgcgtcgaggaggccgcggcccgcacc
caggcgcggatcgactcggggcgccagccggtgatcggcgtcaacaagtaccgggtcgac
agcgatgaggcgatcgaggtccgcgcggtcgacaacacggtggtgcgcgcccagcagatc
gagaagctgcggcggctgcgcgccgagcgcgacgaggcggcctgccagggcgcgctgcgc
gccctgaccgcggccgccgagtccggccccggcgcgggcctggagggcaacctgctggcg
ctggccgtggacgccgcccgcgccaaggccaccgtgggcgagatctccgacgcgctggag
aaggtctatggccgccactccggccagatccgtacgatctccggtgtgtaccgagaagag
gccggaccgtcgtccggcgtggaccgcacccgcacgctggtcgaggcgttcgagcgcgag
gagggccgccgcccccgcatcctggtcgccaagatgggccaggacgggcatgaccgcggc
cagaaggtgatcgccaccgccttcgccgacctgggcttcgacgtcgacgtcggcccgctg
ttccagaccccggaggaggtcgcgcggcaggcggtggaggccgatgtgcacatcgtcggc
gtgtcgtcgctcgcggccggccacctcacgctggtgcccgcgctgcgcgagcagctggcc
gaggcggggcgggaggacatcacgatcgtggtcggcggggtcatcccgccgcaggacgtc
cagaccctgcacgaggccggtgccgccgccgtcttcctgccgggcacggtcatcccggac
gccgcccacgatctggtgcggaagctggccgccgacctgggccacgagctgtag

DBGET integrated database retrieval system