KEGG   Streptomyces malaysiensis: SMALA_7231Help
Entry
SMALA_7231        CDS       T05189                                 

Definition
(GenBank) ornithine aminotransferase
  KO
K00819  ornithine--oxo-acid transaminase [EC:2.6.1.13]
Organism
smal  Streptomyces malaysiensis
Pathway
smal00330  Arginine and proline metabolism
smal01100  Metabolic pathways
smal01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smal00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    SMALA_7231
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:smal01007]
    SMALA_7231
Enzymes [BR:smal01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.13  ornithine aminotransferase
     SMALA_7231
Amino acid related enzymes [BR:smal01007]
 Aminotransferase (transaminase)
  Class III
   SMALA_7231
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: ATL87450
UniProt: A0A291T2Y4
LinkDB All DBs
Position
complement(8891663..8892910)
Genome map
AA seq 415 aa AA seqDB search
MTATTPIASGTAAADGARSSRELIHAEESSLAHNYHPLPVVVARAEGTWVWDVEGRRYLD
MLAGYSALNFGHRHPALIEAAHRQLDQLTLTSRAFHNDRLAGFAEGLAELTGLSMVLPMN
TGAEAVESGIKVARKWAYEVKGVAADQATIVVAADNFHGRTTTIVGFSSDPVARDGFGPF
APGFRIVPYNDLAALEAAVDETTAAVLIEPIQGEAGVIIPDDGYLRGVRELTRRTGTLFI
ADEIQSGLGRTGTTLAVEHESVMPDVLLLGKALGGGIVPVSAVVADRAVLGVLRPGEHGS
TFGGNPLAAAVGSAVVDLLRTGEFQRRAAELGEVLRDGLTALTGKGVLGYRCRGLWAGVD
VDPALGTGREVSERLMAEGILVKDTHGSTIRLAPPLTITREELEGALAALEKVLG
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccaccacccccatcgcctccgggaccgccgcggccgacggcgcccgctcgtcg
cgggaactcatccacgccgaggagtcctcgctcgcgcacaactaccacccgctgcccgtg
gtcgtcgcccgcgccgagggcacctgggtgtgggacgtcgagggacgccgctatctggat
atgctggccggctactcggccctgaacttcggccaccgccaccccgcgctgatcgaggcc
gcccaccgccagctcgaccagctcaccctgacctcgcgggccttccacaacgaccggctg
gccgggttcgccgaggggcttgcggagctcaccgggctgtccatggtgctgccgatgaac
accggcgcggaggccgtggagagcggcatcaaggtcgcccgcaagtgggcgtacgaggtg
aagggcgtcgccgccgaccaggccaccatcgtggtggcggccgacaacttccacggccgt
acgacgacgatcgtcggcttctccagcgaccccgtcgcccgcgatggcttcggccccttc
gccccgggcttccgcatcgtgccgtacaacgacctcgcggccctggaggccgccgtcgac
gagaccacggcggcggtcctcatcgagcccatccagggcgaggcgggcgtcatcatcccc
gatgacggctatctgcgaggggtacgcgaactgacccggcgcaccgggacgctgttcatc
gccgatgagatccagtccggtctgggccgcaccggcaccaccctggccgtcgagcacgag
tccgtgatgccggatgtgctgctgctcggcaaggcgctgggcggcggcatcgtgccggtg
tccgcggtggtggccgaccgggcggtgctcggggtgctgcgccccggtgagcacggctcc
accttcggcggcaatccgctggccgccgcggtcggctcggccgtggtggacctgctgcgc
accggcgaattccagcgccgggcggcggagctgggcgaggtgctgagggacgggctgacc
gcgctgaccggcaagggcgtcctgggctaccgctgccgagggctgtgggcgggcgtcgat
gtggaccccgcgctcggcaccggccgcgaggtgagcgagcggctgatggccgaggggatc
ctggtcaaggacacccatggttcgacgatccggctggcaccgccgctgaccatcacccgt
gaggagctggagggggcgctggcggcgctcgagaaggtgctcggctga

DBGET integrated database retrieval system