KEGG   Streptomyces malaysiensis: SMALA_7425Help
Entry
SMALA_7425        CDS       T05189                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
Organism
smal  Streptomyces malaysiensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase NAD_binding_10 LytR_C
Motif
Other DBs
NCBI-ProteinID: ATL87642
UniProt: A0A291T3C9
LinkDB All DBs
Position
complement(9201900..9202613)
Genome map
AA seq 237 aa AA seqDB search
MSAPTALITGGTSGIGKATAELLHSRGHRVMVTGVSGHADSGLPEDVTVVRADARSLPDI
DRAVEQARRQFGSLDLLFLNAGISRPGAIESTDEAAFDALFDINVKGTFFTLQKALPLLG
EGASVVFTVGAGEGIGAAMTAAKGALLPLMRSLALELAPRRIRVNAVSPGMIDTPVYRRM
GVSRDMLESWARDVPLGRVGAPADIAEAVAFLASDAAGYITGDNLVVSGGIGVHSRP
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcacccacagccttgatcaccggtggaaccagcggcatcggcaaggcgaccgcc
gaactgctccactcccgcggccaccgcgtcatggtcaccggcgtcagcggccacgccgac
tccggactccccgaggacgtcacggtcgtccgggccgacgcacggtccctgccggacatc
gaccgtgcggtggagcaggcacgccgccagttcggctccctcgacctgctcttcctcaac
gcgggcatctcccgccccggcgcgatcgagtcaaccgacgaagccgccttcgacgccctc
ttcgacatcaacgtcaagggcaccttcttcaccctgcaaaaggcgctcccgctcctcggc
gagggcgcctccgtcgtgttcaccgtgggcgccggcgaagggatcggagccgccatgacg
gccgccaagggcgcgctgttgccgctcatgcggtccctcgcgctcgaactcgccccccgc
cgtatccgtgtcaacgccgtcagcccgggaatgatcgacacccccgtctaccgcaggatg
ggcgtctcccgggacatgctcgaatcctgggctcgggacgtcccgctcggccgcgtcggc
gctcccgccgatatcgccgaagccgtggccttcctcgcctcggacgccgccggctacatc
accggcgacaacctcgtcgtctccggaggcatcggcgtccactcccgcccctga

DBGET integrated database retrieval system