KEGG   Streptomyces malaysiensis: SMALA_7426Help
Entry
SMALA_7426        CDS       T05189                                 

Definition
(GenBank) TetR family transcriptional regulator
Organism
smal  Streptomyces malaysiensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_N TetR_C_14 HTH_Tnp_1_2 HTH_7 HTH_23 MerR HTH_29 LZ_Tnp_IS481 HTH_AraC
Motif
Other DBs
NCBI-ProteinID: ATL87643
UniProt: A0A291T3E4
LinkDB All DBs
Position
9202786..9203394
Genome map
AA seq 202 aa AA seqDB search
MKQEAKTAAGAPATLWDRTRQLASQEILATALRLFTEQGYDETTIAQIAREAGVSQRTLF
RYFGTKEDLLGGDQDRFGQVLTDAVGEQPADVDVWEALRAGIAAVQALHDSREQALERFR
LLHNTASLRAGWLEKRLRFQEDLLPLVEARMGTAGGGADPRARAVLATAFACLDAASMTW
VAGDGKGDIMDLYDECLAAVRG
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaggaagccaagacggcggcgggcgcaccggccacgctgtgggaccggacgcgt
cagctggcctcccaggagatcctcgcgacggctctgcgtctgttcaccgagcagggctac
gacgagacgaccatcgcccagatcgcccgggaggccggtgtctcccagcgcaccctcttc
cgctacttcggcaccaaggaggaccttctcggcggcgatcaggaccggttcgggcaagtc
ctgacggacgcggtcggcgaacagcccgccgacgtcgatgtctgggaggccctgcgcgcg
gggatcgccgccgtacaggccctgcacgacagccgcgaacaggccctggagcggttccgt
cttctgcacaacaccgcatcgctgcgcgccggttggctcgagaagcggctgcggttccag
gaggacctgctgccgctcgtcgaggcgcgtatgggcaccgccggcggcggcgcggatccg
agggcccgcgcggtgctcgcgacggcgttcgcatgcctggatgccgcgtcgatgacatgg
gtcgcgggcgacggcaagggcgacatcatggacctgtacgacgagtgcctggcggcggtg
cgcggctga

DBGET integrated database retrieval system